KEGG   Viruses: 1489804
Entry
1489804           CDS       T40000                                 
Symbol
N, MeVgp1
Name
(RefSeq) Measles morbillivirus; nucleocapsid protein
  KO
K19380  Morbillivirus nucleoprotein
Taxonomy
TAX:11234 [GN:T40033]
  Lineage
Viruses; -ssRNA viruses; Riboviria; Orthornavirae; Negarnaviricota; Haploviricotina; Monjiviricetes; Mononegavirales; Paramyxoviridae; Orthoparamyxovirinae; Morbillivirus
Organism
vg  Viruses (Measles morbillivirus)
SSDB
Motif
Pfam: Paramyxo_ncap Ebola_NP
Other DBs
NCBI-GeneID: 1489804
NCBI-ProteinID: NP_056918
RS: NC_001498
UniProt: Q9WMB5 Q784S3
LinkDB
Position
NC_001498:108..1685
AA seq 525 aa
MATLLRSLALFKRNKDKPPITSGSGGAIRGIKHIIIVPIPGDSSITTRSRLLDRLVRLIG
NPDVSGPKLTGALIGILSLFVESPGQLIQRITDDPDVSIRLLEVVQSDQSQSGLTFASRG
TNMEDEADQYFSHDDPSSSDQSRSGWFENKEISDIEVQDPEGFNMILGTILAQIWVLLAK
AVTAPDTAADSELRRWIKYTQQRRVVGEFRLERKWLDVVRNRIAEDLSLRRFMVALILDI
KRTPGNKPRIAEMICDIDTYIVEAGLASFILTIKFGIETMYPALGLHEFAGELSTLESLM
NLYQQMGETAPYMVILENSIQNKFSAGSYPLLWSYAMGVGVELENSMGGLNFGRSYFDPA
YFRLGQEMVRRSAGKVSSTLASELGITAEDARLVSEIAMHTTEDRISRAVGPRQAQVSFL
HGDQSENELPGLGGKEDRRVKQGRGEARESYRETGSSRASDARAAHPPTSMPLDIDTASE
SGQDPQDSRRSADALLRLQAMAGILEEQGSDTDTPRVYNDRDLLD
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggccacacttttgaggagcttagcattgttcaaaagaaacaaggacaaaccacccatt
acatcaggatccggtggagccatcagaggaatcaaacacattattatagtaccaattcct
ggagattcctcaattaccactcgatccagactactggaccggttggtcaggttaattgga
aacccggatgtgagcgggcccaaactaacaggggcactaataggtatattatccttattt
gtggagtctccaggtcaattgattcagaggatcaccgatgaccctgacgttagcatcagg
ctgttagaggttgttcagagtgaccagtcacaatctggccttaccttcgcatcaagaggt
accaacatggaggatgaggcggaccaatacttttcacatgatgatccaagcagtagtgat
caatccaggtccggatggttcgagaacaaggaaatctcagatattgaagtgcaagaccct
gagggattcaacatgattctgggtaccattctagcccagatctgggtcttgctcgcaaag
gcggttacggccccagacacggcagctgattcggagctaagaaggtggataaagtacacc
caacaaagaagggtagttggtgaatttagattggagagaaaatggttggatgtggtgagg
aacaggattgccgaggacctctctttacgccgattcatggtggctctaatcctggatatc
aagaggacacccgggaacaaacctaggattgctgaaatgatatgtgacattgatacatat
atcgtagaggcaggattagccagttttatcctgactattaagtttgggatagaaactatg
tatcctgctcttggactgcatgaatttgctggtgagttatccacacttgagtccttgatg
aatctttaccagcaaatgggagaaactgcaccctacatggtaatcctagagaactcaatt
cagaacaagttcagtgcaggatcataccctctgctctggagctatgccatgggagtagga
gtggaacttgaaaactccatgggaggtttgaactttggtcgatcttactttgatccagca
tattttagattagggcaagagatggtgaggaggtcagctggaaaggtcagttccacattg
gcatccgaactcggtatcactgccgaggatgcaaggcttgtttcagagattgcaatgcat
actactgaggacaggatcagtagagcggtcggacccagacaagcccaagtgtcatttcta
cacggtgatcaaagtgagaatgagctaccaggattggggggcaaggaagataggagggtc
aaacagggtcggggagaagccagggagagctacagagaaaccgggtccagcagagcaagt
gatgcgagagctgcccatcctccaaccagcatgcccctagacattgacactgcatcggag
tcaggccaagatccgcaggacagtcgaaggtcagctgacgccctgctcaggctgcaagcc
atggcaggaatcttggaagaacaaggctcagacacggacacccctagggtatacaatgac
agagatcttctagactag

DBGET integrated database retrieval system