KEGG   Viruses: 1496947
Entry
1496947           CDS       T40000                                 
Symbol
E7, HpV26gp2
Name
(RefSeq) Human papillomavirus type 26; early protein
  KO
K21809  HPV protein E7
Taxonomy
TAX:333762
  Lineage
Viruses; dsDNA viruses; Monodnaviria; Shotokuvirae; Cossaviricota; Papovaviricetes; Zurhausenvirales; Papillomaviridae; Firstpapillomavirinae; Alphapapillomavirus; Alphapapillomavirus 5
Organism
vg  Viruses (Alphapapillomavirus 5)
SSDB
Motif
Pfam: E7 Rrp44_CSD1
Other DBs
NCBI-GeneID: 1496947
NCBI-ProteinID: NP_041783
RS: NC_001583
UniProt: P36824 A0A219KXK9
LinkDB
Position
NC_001583:556..870
AA seq 104 aa
MHGNIINIEDVILDLVPQPEIDLRCYEQLDYEQFDSSDEDETDNMRDQQARQAGQEVCYR
IEAQCCMCNSIVQLAVQSSRQNVRVLEQMLMEDVSLVCHQCAAQ
NT seq 315 nt   +upstreamnt  +downstreamnt
atgcatggaaacataattaatattgaagatgtaatactagatctggtgccgcaacccgaa
attgacctacgctgctacgaacaattggactatgaacaatttgacagctcagatgaggat
gaaacagataatatgcgtgaccagcaggccagacaagctggacaagaagtgtgttacaga
attgaagcacaatgttgtatgtgtaatagtatagtgcagctagctgtgcagagcagtcga
cagaacgttcgagtgctggagcagatgttaatggaagacgtgtccttggtgtgccatcag
tgtgctgcacagtaa

DBGET integrated database retrieval system