KEGG   Viruses: 1497433
Entry
1497433           CDS       T40000                                 
Symbol
E7, HpV54gp2
Name
(RefSeq) Human papillomavirus type 54; transforming protein
  KO
K21809  HPV protein E7
Taxonomy
  Lineage
Viruses; dsDNA viruses; Monodnaviria; Shotokuvirae; Cossaviricota; Papovaviricetes; Zurhausenvirales; Papillomaviridae; Firstpapillomavirinae; Alphapapillomavirus; Alphapapillomavirus 13
Organism
vg  Viruses (Alphapapillomavirus 13)
SSDB
Motif
Pfam: E7
Other DBs
NCBI-GeneID: 1497433
NCBI-ProteinID: NP_043289
RS: NC_001676
UniProt: Q81019 A0A0N7I701
LinkDB
Position
NC_001676:536..823
AA seq 95 aa
MHGNVATIEDIVLDLKPEPFDLYCREQLEDSDAEDETAVTQPDKQAFKVLSQCGGVCCKT
VRLCVYSTHTGIRVLQELLHQDALQIVCPTCASRL
NT seq 288 nt   +upstreamnt  +downstreamnt
atgcatggaaatgtggctacaattgaggatatagtccttgatttaaaaccagaaccgttt
gacctgtactgcagggagcaattagaagactctgatgcagaagatgagacagcagtaaca
caacctgacaaacaagcatttaaggtgttaagccagtgtggaggtgtgtgttgtaagaca
gtacggctatgtgtgtatagcacgcacacaggcataagggtactgcaggaactgcttcat
caggacgcactgcaaatagtgtgtcccacctgtgcttcacgactataa

DBGET integrated database retrieval system