KEGG   Viruses: 1724698
Entry
1724698           CDS       T40000                                 

Gene name
BIVgp4
Definition
(RefSeq) Bovine immunodeficiency virus; hypothetical protein
  KO
K19258  HIV-1 protein Tat
Taxonomy
TAX:11657
  Lineage
Viruses; ssRNA-RT viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes; Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus
Organism
vg  Viruses (Bovine immunodeficiency virus)
SSDB
Motif
Pfam: Tat
Other DBs
NCBI-GeneID: 1724698
NCBI-ProteinID: NP_040565
RS: NC_001413
UniProt: P19564
LinkDB
Position
NC_001413:5228..5539
AA seq 103 aa
MPGPWVAMIMLPQPKESFGGKPIGWLFWNTCKGPRRDCPHCCCPICSWHCQLCFLQKNLG
INYGSGPRRRGTRGKGRRIRRTASGGDQRREADSQRSFTNMDQ
NT seq 312 nt   +upstreamnt  +downstreamnt
atgcccggaccttgggtggcgatgataatgttgccacagcccaaagaaagctttggagga
aagccaattggctggcttttctggaacacgtgcaaaggacctaggcgggactgtccacat
tgttgttgtcccatatgtagttggcattgtcagctttgctttttgcagaaaaatctagga
atcaactatggatcaggacctagacggcgcggaacgcggggaaaggggaggaggatccga
agaactgcttcaggaggagatcaacgaagggaggctgacagccagagaagctttacaaac
atggatcaataa

DBGET integrated database retrieval system