KEGG   Viruses: 19737738
Entry
19737738          CDS       T40000                                 

Symbol
HM89_gp015
Name
(RefSeq) Pigeonpox virus; interleukin 10
  KO
K21533  EBV viral interleukin 10
Taxonomy
TAX:10264
  Lineage
Viruses; dsDNA viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota; Pokkesviricetes; Chitovirales; Poxviridae; Chordopoxvirinae; Avipoxvirus
Organism
vg  Viruses (Pigeonpox virus)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 19737738
NCBI-ProteinID: YP_009046254
RS: NC_024447
UniProt: A0A068EG07
LinkDB
Position
NC_024447:complement(19295..19831)
AA seq 178 aa
MRVMRCLKVIMVLIVVIFPINILSNKISSDTNSCDHKKRHRIPGLIRELHNKFNDVKDYF
QSRDHDLSTMLLTNLESTLKGPCGCRTLDKLLTRYMLVASNTIPDIPQDIESKVHDIGNL
LSDLRYIMKECYYICRGYDIPIDNINNYYNKMGVNATNKVVGEFDILLDGIRDLLENI
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcgcgtcatgcggtgtcttaaggttattatggtattgatagtagttatatttcctatt
aacattctctctaacaagatttcttcggatactaattcttgtgatcataaaaaacgtcat
aggataccgggtttaattagagagttacataataaatttaacgatgtaaaagattatttt
caatcaagggatcatgatttatctactatgttattgacaaatttggaaagtactctaaaa
ggcccttgtggttgtcgtactctagataaattactaactagatacatgttagtagcatcc
aatactatacccgatattccacaagatatagaatccaaagttcatgatattggtaacctc
cttagtgatttacggtatataatgaaagaatgttattatatatgcaggggttatgatatt
cctattgataatatcaataattactataacaaaatgggtgtaaatgctactaataaagta
gtaggggaatttgatattctattagatggtataagagatttactagaaaatatataa

DBGET integrated database retrieval system