Viruses: 22111137
Help
Entry
22111137 CDS
T40000
Symbol
97, PBI_121Q_97
Name
(RefSeq) Escherichia phage 121Q; hypothetical protein
Virus
1555202
Escherichia phage 121Q
Taxonomy
SSDB
Ortholog
Paralog
GFIT
VOG
VOG cluster
Other DBs
NCBI-GeneID:
22111137
NCBI-ProteinID:
YP_009101691
RS:
NC_025447
UniProt:
A0A097EX30
LinkDB
All DBs
Position
NC_025447:65661..65804
Genome browser
AA seq
47 aa
AA seq
DB search
MPVRNSTSRFTLQQKADLLNMANKDSNFYYLVLGGSVEKIDLRECMK
NT seq
144 nt
NT seq
+upstream
nt +downstream
nt
atgccagtacgtaacagtacttcacgctttacgcttcaacagaaagcagatcttttgaat
atggctaacaaagattctaatttttactatctagtactcggtgggtcagtagaaaagatt
gacctacgtgagtgtatgaaataa
DBGET
integrated database retrieval system