KEGG   Viruses: 26123438
Entry
26123438          CDS       T40000                                 
Symbol
N, ASN19_gp1
Name
(RefSeq) Phocine morbillivirus; nucleocapsid protein
  KO
K19380  Morbillivirus nucleoprotein
Taxonomy
TAX:11240
  Lineage
Viruses; -ssRNA viruses; Riboviria; Orthornavirae; Negarnaviricota; Haploviricotina; Monjiviricetes; Mononegavirales; Paramyxoviridae; Orthoparamyxovirinae; Morbillivirus
Organism
vg  Viruses (Phocine morbillivirus)
SSDB
Motif
Pfam: Paramyxo_ncap
Other DBs
NCBI-GeneID: 26123438
NCBI-ProteinID: YP_009177597
RS: NC_028249
UniProt: R4MZM0
LinkDB
Position
NC_028249:108..1679
AA seq 523 aa
MASLLKSLSLFKKTREQPPLASGSGGAIRGIKHVIIVLIPGDSSIVTRSRLLDRLVRMVG
DPEVSGPKLTGVLISILSLFVESPGQLIQRIIDDPDISIKLVEVIPSINSTCGLTFASRG
ASLDAEADEFFGTMDEGSKDHNQMGWLENKDIIDIEVNDAEQFNILLASILAQIWILLAK
AVTAPDTAADSEMRRWIKYTQQRRVIGEFRMNKIWLDIVRNRIAEDLSLRRFMVALILDI
KRSPGNKPRIAEMICDIDNYIVEAGLASFILTIKFGIETMYPALGLHEFSGELTTIESLM
VLYQQMGETAPYMVILENSVQNKFSAGSYPLLWSYAMGVGVELENSMGGLNFGRSYFDPA
YFRLGQEMVRRSAGKVSSTFAAEFGITKEEAQLVSEIVSRTTEDRTTRATGPKQSQITFL
HSERNEAPNQRLPPITMKSEFQGGDKYSNQLIDDRLSGYTSDVQSSEWDESRQITQLTQE
GDHDNDQQSMEALAKMRQLTKILNQSDTNGEVSPAYNDRDLLS
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggccagtcttctcaaaagcctgagcttgttcaaaaagacaagggaacaacccccattg
gcttcaggatctggcggggcaataagagggataaaacatgttattatagtcttgatccct
ggtgactcgagcattgtaactagatcaagactattggacagacttgtcagaatggttgga
gaccctgaagttagtggtcccaagttgaccggggttctgatcagcatcctctcattattt
gtagaatcccctggacagttaattcagagaatcattgatgatcctgacatcagtataaag
ttagtggaggtaatacccagtattaattctacctgcggtcttacatttgcatccagaggt
gcgagcttggatgctgaagctgatgagtttttcgggactatggacgagggttcaaaggat
cataatcaaatgggctggttagaaaataaagatataatcgacatcgaggtgaatgacgca
gagcagttcaatatcttactagcgtcaatcctggctcaaatctggatcttgcttgccaag
gccgtaactgctccagacactgcggctgattcagaaatgagaagatggattaagtacact
cagcagagacgtgtgataggagaatttagaatgaataaaatatggcttgatatagttagg
aacagaattgctgaggatttgtctttgaggcgatttatggtggcattaatattagatatc
aaaaggtctccgggcaataaaccaagaattgccgaaatgatctgtgatatagacaactat
atagtagaagctggcctggcaagctttatcttaactatcaaatttggcatcgaaactatg
tacccggcacttggtctacatgagttctctggagagttgacaaccattgaatcacttatg
gttttatatcaacagatgggtgaaacggcaccgtatatggtgattcttgagaactcagtt
cagaataaattcagtgcaggctcttatccgttgctttggagttatgctatgggagtcggg
gtcgagcttgagaattccatgggagggttaaacttcggtcgatcttactttgacccagct
tacttccgacttggtcaagaaatggtcaggagatctgctggtaaagtgagctctacattt
gcggccgaatttggcatcaccaaagaggaggcgcaactagtgtcagaaatagtatcaaga
acaaccgaagatagaacaactagggcaactggtcctaaacaatcccagatcacatttcta
cactctgaaagaaatgaagcacctaaccaaagactccctcccatcaccatgaagtctgaa
ttccaaggaggtgataagtattccaatcagctcattgatgatcggctgtctgggtatact
tctgatgttcaatcatctgaatgggacgagtcacgccagatcacacaattgacacaggaa
ggggaccatgacaatgatcaacaatcaatggaggctctcgccaaaatgagacagctcacc
aagattctaaatcagtcagatacaaatggggaggtctcccctgcttataatgatagggac
ctgctcagctaa

DBGET integrated database retrieval system