KEGG   Viruses: 2658690
Entry
2658690           CDS       T40000                                 
Symbol
N, DolMVgp1
Name
(RefSeq) Dolphin morbillivirus; nucleocapsid protein
  KO
K19380  Morbillivirus nucleoprotein
Taxonomy
TAX:37131
  Lineage
Viruses; -ssRNA viruses; Riboviria; Orthornavirae; Negarnaviricota; Haploviricotina; Monjiviricetes; Mononegavirales; Paramyxoviridae; Orthoparamyxovirinae; Morbillivirus; Cetacean morbillivirus
Organism
vg  Viruses (Cetacean morbillivirus)
SSDB
Motif
Pfam: Paramyxo_ncap Ebola_NP
Other DBs
NCBI-GeneID: 2658690
NCBI-ProteinID: NP_945024
RS: NC_005283
UniProt: Q66412
LinkDB
Position
NC_005283:108..1679
AA seq 523 aa
MATLLRSLALFKRNKDRTPLIAGSGGAIRGIKHVIVVPVPGDSSIVTRSRLLDRLVRLAG
DPYISGPKLTGVMISILSLFVESPSQLIQRITDDPDVSIRLVEVIQSEKSLSGLTFASRG
ANMEDEADDYFSIQAGEEGDTRGTHWFENKEIVEIEVQDPEEFNILLASILAQIWILLAK
AVTAPDTAADSETRRWIKYTQQRRVVGEFRLDKGWLDAVRNRIAEDLSLRRFMVALILDI
KRTPGNKPRIAEMICDIDTYIVEAGLASFILTIKFGIETMYPALGLHEFSGELTTVESLM
NLYQQMGETAPYMVILENSIQNKFSAGSYPLLWSYAMGVGVELENSMGGLNFGRSYFDPA
YFRLGQEMVRRSAGKVSSSLAAELGITAEDAKLVSEIAAQANDDRANRAIGPKQNQISFL
HPDRGDASTPGNILRANEGDGSTRMKRGGNIATPKGTSIDQTSTTLSKDTLDIDEQSDNT
DDPISIQKSAEALAKMRAMAKLLENQGPRDVTAHVYNDKDLLG
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggcgacacttcttcggagtctagctctgttcaagaggaacaaagatagaacaccccta
attgcaggttcaggaggagccataagagggattaagcatgttatcgtagtcccagtaccc
ggtgattcatcgattgtcactaggtcaagattattggacaggttagtaagacttgctggt
gacccttatataagtggacctaagctgacaggcgtcatgatcagtatactatcattgttt
gttgaatcacccagtcaactaatacagcgaatcactgacgacccagatgtcagcatcaga
ttagttgaagtaatccaaagtgagaagtccctatcagggctcacttttgcatccagaggc
gctaatatggaggatgaggcggatgactatttctctattcaagcaggggaggaaggggac
accagaggaacccattggtttgagaacaaagagatagttgaaattgaggttcaagaccca
gaagaattcaacatactattggcatctattcttgcacaaatttggatcctattagccaag
gcagtcactgctccagatactgcagctgactccgagacgaggcggtggattaaatatact
cagcaacgccgtgtagtgggtgagtttcggcttgacaagggatggttggatgctgtgaga
aatcggattgcggaggacctatcgttgaggagattcatggtggcattaattttagatatc
aagagaacaccagggaacaaacccaggattgccgagatgatatgcgacatagacacctat
atcgtcgaggcaggtcttgctagcttcatcctaactatcaaattcgggatcgaaacaatg
tacccggccttagggttgcatgaattctcgggtgaattaactacagttgagtctctaatg
aacctctaccaacagatgggcgagactgcaccgtacatggtaattcttgaaaactcaatt
cagaacaagttcagtgcaggttcatacccgctattatggagctatgcaatgggagttgga
gttgaacttgaaaattcaatgggtggacttaattttggtcgttcttacttcgaccctgca
tatttcagactgggtcaagagatggtcaggagatcagcaggcaaggtgagctcatcgcta
gccgcagaactagggatcacagccgaggacgccaaacttgtctccgagattgctgcgcag
gctaatgacgacagagctaatagagcaataggtcccaaacaaaaccagatatcgtttctt
catcctgacagaggcgatgccagtactccagggaacatccttcgcgcaaacgagggtgac
gggtccacccggatgaaaagaggggggaacattgctacaccaaaagggacaagcatagat
cagacatcaacgactctcagcaaagacactctagacattgatgaacagtccgacaacact
gacgacccaattagtatccaaaaatcagctgaggcattagccaagatgagagccatggcc
aagctattggaaaaccaaggcccgcgtgatgtcactgcgcacgtttataatgataaagat
ctacttggctga

DBGET integrated database retrieval system