KEGG   Viruses: 2703410
Entry
2703410           CDS       T40000                                 

Symbol
UL44, HHV1gp00p31
Name
(RefSeq) Human alphaherpesvirus 1; envelope glycoprotein C
  KO
K19256  Simplexvirus envelope glycoprotein C
Taxonomy
TAX:10298 [GN:T40073]
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Simplexvirus
Organism
vg  Viruses (Human alphaherpesvirus 1)
SSDB
Motif
Pfam: Marek_A Ig_2 NAD_binding_2 Lep_receptor_Ig
Other DBs
NCBI-GeneID: 2703410
NCBI-ProteinID: YP_009137119
RS: NC_001806
UniProt: Q8UYE2 G8HBF8
LinkDB
Position
NC_001806:96312..97847
AA seq 511 aa
MAPGRVGLAVVLWSLLWLGAGVSGGSETASTGPTITAGAVTNASEAPTSGSPGSAASPEV
TPTSTPNPNNVTQNKTTPTEPASPPTTPKPTSTPKSPPTSTPDPKPKNNTTPAKSGRPTK
PPGPVWCDRRDPLARYGSRVQIRCRFRNSTRMEFRLQIWRYSMGPSPPIAPAPDLEEVLT
NITAPPGGLLVYDSAPNLTDPHVLWAEGAGPGADPPLYSVTGPLPTQRLIIGEVTPATQG
MYYLAWGRMDSPHEYGTWVRVRMFRPPSLTLQPHAVMEGQPFKATCTAAAYYPRNPVEFV
WFEDDHQVFNPGQIDTQTHEHPDGFTTVSTVTSEAVGGQVPPRTFTCQMTWHRDSVTFSR
RNATGLALVLPRPTITMEFGVRHVVCTAGCVPEGVTFAWFLGDDPSPAAKSAVTAQESCD
HPGLATVRSTLPISYDYSEYICRLTGYPAGIPVLEHHGSHQPPPRDPTERQVIEAIEWVG
IGIGVLAAGVLVVTAIVYVVRTSQSRQRHRR
NT seq 1536 nt   +upstreamnt  +downstreamnt
atggccccggggcgggtgggccttgccgtggtcctgtggagcctgttgtggctcggggcg
ggggtgtccgggggctcggaaactgcctccaccgggcccacgatcaccgcgggagcggtg
acgaacgcgagcgaggcccccacatcggggtcccccgggtcagccgccagcccggaggtc
acccccacatcgaccccaaaccccaacaatgtcacacaaaacaaaaccacccccaccgag
ccggccagccccccaacaacccccaagcccacctccacgcccaaaagcccccccacgtcc
acccccgaccccaaacccaagaacaacaccacccccgccaagtcgggccgccccactaaa
ccccccgggcccgtgtggtgcgaccgccgcgacccattggcccggtacggctcgcgggtg
cagatccgatgccggtttcggaattccacccgcatggagttccgcctccagatatggcgt
tactccatgggtccgtcccccccaatcgctccggctcccgacctagaggaggtcctgacg
aacatcaccgccccacccgggggactcctggtgtacgacagcgcccccaacctaacggac
ccccacgtgctctgggcggagggggccggcccgggcgccgaccctccgttgtattctgtc
accgggccgctgccgacccagcggctgattatcggcgaggtgacgcccgcgacccaggga
atgtattacttggcctggggccggatggacagcccgcacgagtacgggacgtgggtgcgc
gtccgcatgttccgccccccgtctctgaccctccagccccacgcggtgatggagggtcag
ccgttcaaggcgacgtgcacggccgccgcctactacccgcgtaaccccgtggagtttgtc
tggttcgaggacgaccaccaggtgtttaacccgggccagatcgacacgcagacgcacgag
caccccgacgggttcaccacagtctctaccgtgacctccgaggctgtcggcggccaggtc
cccccgcggaccttcacctgccagatgacgtggcatcgcgactccgtgacgttctcgcga
cgcaatgccaccgggctggccctggtgctgccgcggccaaccatcaccatggaatttggg
gtccggcatgtggtctgcacggccggctgcgtccccgagggcgtgacgtttgcctggttc
ctgggggacgacccctcaccggcggctaagtcggccgttacggcccaggagtcgtgcgac
caccccgggctggctacggtccggtccaccctgcccatttcgtacgactacagcgagtac
atctgtcggttgaccggatatccggccgggattcccgttctagaacaccacggcagtcac
cagcccccacccagggaccccaccgagcggcaggtgatcgaggcgatcgagtgggtgggg
attggaatcggggttctcgcggcgggggtcctggtcgtaacggcaatcgtgtacgtcgtc
cgcacatcacagtcgcggcagcgtcatcggcggtaa

DBGET integrated database retrieval system