KEGG   Viruses: 2947853
Entry
2947853           CDS       T40000                                 

Symbol
BPSVgORF127
Name
(RefSeq) Bovine papular stomatitis virus; ORF127 IL-10
  KO
K21533  EBV viral interleukin 10
Taxonomy
TAX:129727
  Lineage
Viruses; dsDNA viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota; Pokkesviricetes; Chitovirales; Poxviridae; Chordopoxvirinae; Parapoxvirus
Organism
vg  Viruses (Bovine papular stomatitis virus)
SSDB
Motif
Pfam: IL10 IL22 CLZ
Other DBs
NCBI-GeneID: 2947853
NCBI-ProteinID: NP_958035
RS: NC_005337
UniProt: Q6TV62
LinkDB
Position
NC_005337:126898..127455
AA seq 185 aa
MANVMYVVLVLNILLTQIHVSNSYCTMCSTGVCKENPHQKQECENTGHQLPHMLRELRAA
FGKVKTFFQMKDQLHSLLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKE
HVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVEKVKRVFSELQERGVYKAMSEFDIFINY
IETYM
NT seq 558 nt   +upstreamnt  +downstreamnt
atggccaatgtaatgtatgtagttttggttttgaatattctacttacgcaaattcatgta
tcaaactcatactgtactatgtgctccactggtgtatgtaaagaaaacccacaccagaaa
caagaatgcgaaaacacgggacatcaattacctcacatgttacgagaactccgggcagca
tttggtaaagtcaaaacattttttcagatgaaagatcagttacatagtttgcttctcaca
cagtctcttttggatgacttcaaaggctatttagggtgccaagctctgtctgagatgatt
cagttctacctcgaagaggtcatgccacaggcagaaaatcacggacccgacataaaagaa
cacgtcaattccctgggtgaaaagctgaagacattgagacttcgactgcgtcgctgccac
cgctttctcccgtgcgagaacaagagcaaggcggtggaaaaggtgaagagagtgttcagc
gagcttcaggaaagaggcgtgtacaaggccatgagtgagtttgacatattcatcaactac
atcgagacttacatgtag

DBGET integrated database retrieval system