KEGG   Viruses: 2949788
Entry
2949788           CDS       T40000                                 
Symbol
CeHV15gBHRF1
Name
(RefSeq) Macacine gammaherpesvirus 4; BHRF1
  KO
K19463  Lymphocryptovirus apoptosis regulator BHRF1
Taxonomy
TAX:45455
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae/Gammaherpesvirinae; Lymphocryptovirus
Organism
45455  Viruses (Macacine gammaherpesvirus 4)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 2949788
NCBI-ProteinID: YP_067944
RS: NC_006146
UniProt: Q8UZJ4
LinkDB
Position
NC_006146:35902..36477
AA seq 191 aa
MAFSTRDLLLALCMRDSHVHGNEGLHPVLELASRESPSSLSAGDTLVLRVHVLLEQIIEQ
NAGAFLEALDRFLSNTEEWDVDFTRVFQEIFHRGNPTLGRALAWLAWCMHACRTLCCNRN
TPYYVVDLSVRGMLEASEGLDAWIHQQGGWPSLLRGNRSNTGSPILTAFLAGLTLTFVVV
CSYLFISGRRR
NT seq 576 nt   +upstreamnt  +downstreamnt
atggccttttcaacaagagatttactgttagccctgtgtatgcgggacagtcacgttcat
ggaaacgagggtctgcatcctgtgttggagttagcatcaagagaatcaccctccagcctc
tctgcgggggacactctggttctacgtgtccatgtactgcttgagcaaataattgaacaa
aatgcgggtgcctttttagaagccttggacagatttttatcaaacaccgaagagtgggat
gtggattttaccagagtgtttcaagaaatcttccaccgtggaaatcccactctgggacga
gcgttggcctggctggcctggtgcatgcatgcctgcaggacgttgtgttgtaacaggaat
actccctactatgttgtggacctgtcggttcgtgggatgttagaagccagcgaaggcctt
gatgcttggattcaccagcaaggcggctggccttctttactgaggggcaaccgttcaaac
accggaagccccatattgactgcatttttagctggactaactttaactttcgtagttgtg
tgtagctatctctttatctctggaagaagacgctga

DBGET integrated database retrieval system