KEGG   Viruses: 2952505
Entry
2952505           CDS       T40000                                 

Symbol
UL44, SuHV1_gp30
Name
(RefSeq) Suid alphaherpesvirus 1; envelope glycoprotein C
  KO
K19256  Simplexvirus envelope glycoprotein C
Taxonomy
TAX:10345
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Varicellovirus
Organism
vg  Viruses (Suid alphaherpesvirus 1)
SSDB
Motif
Pfam: Marek_A C1-set
Other DBs
NCBI-GeneID: 2952505
NCBI-ProteinID: YP_068347
RS: NC_006151
UniProt: Q5PPB2
LinkDB
Position
NC_006151:54029..55468
AA seq 479 aa
MASLARAMLALLALYAAAIAAAPSTTTALDTTPNGGGGGNSSEGELSPSPPPTPAPASPE
AGAVSTPPVPPPSVSRRKPPRNNNRTRVHGDKATAHGRKRIVCRERLFSARVGDAVSFGC
AVFPRAGETFEVRFYRRGRFRSPDADPEYFDEPPRPELPRERLLFSSANASLAHADALAP
VVVEGERATVANVSGEVSVRVAAADAETEGVYTWRVLSANGTEVRSANVSLLLYSQPEFG
LSAPPVLFGEPFRAVCVVRDYYPRRSVRLRWFADEHPVDAAFVTNSTVADELGRRTRVSV
VNVTRADVPGLAAADAADALAPSLRCEAVWYRDSVASQRFSEALRPHVYHPAAVSVRFVE
GFAVCDGLCVPPEARLAWSDHAADTVYHLGACAEHPGLLNVRSARPLSDLDGPVDYTCRL
EGLPSQLPVFEDTQRYDASPASVSWPVVSSMIVVIAGIGILAIVLVIMATCVYYRRAGP
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggcctcgctcgcgcgtgcgatgctcgctctgctggcgctctacgcggcggccatcgcc
gcggcgccgtcgaccacgacggcgctcgacacgacgcccaacgggggcggcggcggcaac
agcagcgagggagaactctcgccctctccgcccccgacccccgcgcccgcctcgcccgag
gcgggcgcggtctcgacgcccccggtcccgccgccctcggtctcgcgcaggaagcccccg
cggaacaacaaccggacgcgcgtccacggcgacaaggccaccgcgcacgggcgcaagcgc
atcgtgtgccgggagcggctgttctcggcgcgggtgggggacgcggtcagcttcgggtgc
gccgtcttcccgcgcgccggggagaccttcgaggtccgcttctaccgccgcgggcgcttc
cgctcgcccgacgccgaccccgagtactttgacgagcccccgcgcccggagctcccgcgg
gagcggctcctcttcagctccgccaacgcctccctcgcccacgcggacgcgctcgcgccc
gtcgtcgtcgagggcgagcgcgcgaccgtcgccaacgtctcgggcgaggtgtccgtgcgc
gtggccgcggcggacgccgagaccgagggcgtctacacgtggcgcgtgctgtccgccaac
ggcaccgaggtccggagcgccaacgtctcgctcctcctgtacagccagcccgagttcggc
ctgagcgcgccgcccgtcctcttcggtgagcccttccgggcggtgtgcgtcgtccgcgac
tactacccgcggcgcagcgtgcgcctgcgctggttcgcggacgagcacccggtggacgcc
gccttcgtgaccaacagcaccgtggccgacgagctcgggcgccgcacgcgcgtctccgtg
gtgaacgtgacgcgcgcggacgtcccgggcctcgcggccgcggacgccgcggacgcgctc
gcgccgagcctgcgctgcgaggccgtgtggtaccgcgacagcgtggcctcgcagcgcttc
tccgaggccctgcgcccccacgtctaccacccggcggcggtctcggtgcgcttcgtcgag
ggcttcgccgtctgcgacggcctctgcgtgcccccggaggcgcgcctcgcctggtccgac
cacgccgccgacaccgtctaccacctcggcgcctgcgcggagcaccccggcctgctcaac
gtgcggagcgcccgcccgctgtcggacctcgacgggcccgtcgactacacctgccgcctc
gagggcctgccctcgcagctgcccgtcttcgaggacacgcagcgctacgacgcctccccc
gcgtccgtgagctggcccgtcgtgagcagcatgatcgtcgtcatcgccggcatcgggatc
ctggccatcgtgctggtcatcatggcgacgtgcgtctactaccgccgggcggggccgtga

DBGET integrated database retrieval system