KEGG   Viruses: 3021777
Entry
3021777           CDS       T40000                                 
Symbol
RPVgp1
Name
(RefSeq) Rinderpest virus (strain Kabete O); N protein
  KO
K19380  Morbillivirus nucleoprotein
Taxonomy
TAX:11242
  Lineage
Viruses; -ssRNA viruses; Riboviria; Orthornavirae; Negarnaviricota; Haploviricotina; Monjiviricetes; Mononegavirales; Paramyxoviridae; Orthoparamyxovirinae; Morbillivirus; Rinderpest morbillivirus
Organism
vg  Viruses (Rinderpest morbillivirus)
SSDB
Motif
Pfam: Paramyxo_ncap Ebola_NP
Other DBs
NCBI-GeneID: 3021777
NCBI-ProteinID: YP_087120
RS: NC_006296
UniProt: Q629I6
LinkDB
Position
NC_006296:108..1685
AA seq 525 aa
MASLLKSLALFKRAKDKPPLAAGSGGAIRGIKHVIVVPIPGDSSITTRSRLLDRLVKMVG
DPDISGPKLTGALISILSLFVESPGQLIQRITDDPDISIKLVEVVQSDKTQSGLTFASRG
TSMDDEADRYFTYEEPNDGEERQSYWFENRDIQDIEIQDPEGFNMILATILAQIWILLAK
AVTAPDTAADSELRRWVKYTQQRRVIGEFRLDKGWLDTVRNRVAEDLSLRRFMVALILDI
KRTPGNKPRIAEMICDIDTYIVEAGLASFILTIKFGIETMYPALGLHEFAGELSTIESLM
NLYQQMGELAPYMVILENSIQNKFSAGAYPLLWSYAMGIGVELENSMGGLNFGRSYFDPA
YFRLGQEMVRRSAGKVSSNLASELGITEEEARLVSEIAAYTSDDRNNRTSGPKQAQVSFL
RTDQGSEAQHSASKKDEARAPQVKKETRTSSKSDKHKEGTDKEPVSSSAMTLIDVDTTLE
ADTDPLESKKSAEALLRLQAMAGILGDSTLGNDSLRAYNDKDLLN
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggcttctctcttgaagagcttagctctgttcaaaagggccaaagacaagccacccctt
gctgcaggctctggtggggctatccggggaatcaaacatgtcattgttgttccgattcct
ggggattcctcaatcaccacaagatcccgcctcctagaccgtctcgttaaaatggtggga
gacccagacatcagtggccctaaattaaccggggctctcatcagcatcttatcactgttt
gtcgagtcaccaggccaacttattcagagaatcactgatgaccctgatatcagcattaaa
ttggtggaggtagtccaaagtgacaaaactcaatcagggctgacatttgcctctaggggt
acgagcatggatgacgaggctgatagatatttcacttatgaagaacccaatgacggagaa
gaaaggcagtcttactggtttgagaatcgagatattcaagacattgagatccaggatcca
gaagggttcaatatgatactggcaaccatcttagcccagatctggatcttactagctaaa
gcagtcacagcccctgatactgcagccgattcagagttacggaggtgggtgaaatacact
caacaaaggagggtaattggagaattcagacttgacaaaggatggcttgacacagtgcgc
aacagggtagcagaagatctctctttacgcagatttatggtggcattgatcttagatatc
aagagaaccccaggcaataaaccaaggatcgctgaaatgatctgtgacattgatacctac
atagtggaggcagggttggccagttttatactcactatcaaatttggtatagaaacgatg
tacccagcactgggcctgcatgaattcgccggagagctctccacaatcgagtctcttatg
aatctgtaccagcaaatgggtgaactggctccttatatggtgatcttagagaactcaatc
cagaacaagttcagtgcaggagcataccccctgttgtggagctatgctatggggattggg
gttgaattagagaattctatggggggacttaattttggcaggtcgtactttgaccctgca
tatttcagattaggacaagaaatggtaaggaggtcagctgggaaggtcagctccaacctg
gcatctgagctcggcatcaccgaggaggaagcaagacttgtctctgagatcgcagcatac
acaagtgatgatcggaacaatagaacctctggacccaaacaggcccaggtttcattcctt
cgcaccgatcaagggagtgaggcccagcacagcgcaagcaagaaagatgaagctagagca
ccccaggtcaagaaggaaaccaggaccagcagcaagtcagacaagcacaaggaaggtaca
gacaaagaacctgtaagctcctcagctatgactctgattgatgtggacacaaccctcgag
gcagatactgatcctctagagagcaagaagtcagcagaggctcttcttagactgcaggct
atggccggcatcttaggggactcaacccttggcaatgacagtctgagagcatacaacgac
aaggatcttctcaactga

DBGET integrated database retrieval system