KEGG   Viruses: 3077557
Entry
3077557           CDS       T40000                                 

Gene name
US27, HHV5wtgp157
Definition
(RefSeq) Human betaherpesvirus 5; envelope glycoprotein US27
  KO
K22783  HCMV envelope glycoprotein US27
Taxonomy
TAX:10359 [GN:T40080]
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Human betaherpesvirus 5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx TMIE RIFIN Abhydrolase_9_N
Other DBs
NCBI-GeneID: 3077557
NCBI-ProteinID: YP_081611
RS: NC_006273
UniProt: F5HDK1 D2K3X1
LinkDB
Position
NC_006273:224133..225227
AA seq 364 aa
MTTSTTTTTNIMLQVSNVTNHTLNSTEIYQLFEYTRFGVWLMCIVGTFLNMLVITTILYY
RRKKKSPSDTYICNLAVADLLIVVGLPFFLEYAKHHPKLSREVVCSGLNACFYICLFAGV
CFLINLSMDRYCVIVWGVELNRVRNNKRATCWVVIFWILAALMGMPHYLMYSHTNNECVG
EFANETSGWFPVFLNTKVNICGYLAPIVLMAYTYNRMVRFIINYVGKWHMQTLHVLLVVV
VSFASFWFPFNLALFLESIRLLSGTQNETLQTVITFCLYVGQFLAYVRACLNPGIYILVG
TQMRKDMWTTLRVFACCCVKQEIPYQDIDIELQKDIQRRAKHTKRTHYDRKHAPMESGEE
EFLL
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgactacatctactacaactaccactaatatcatgctacaggtgagcaacgtaacgaat
cacaccttgaatagcaccgaaatttatcagttgttcgagtacactcggttcggggtatgg
ttgatgtgcatcgtgggcacgtttctgaacatgctggtgattaccaccatcctgtactac
cgtcgtaagaaaaaatctccgagcgatacctacatctgcaacctggctgtagccgatctg
ttgattgtcgtcggcctgccgttttttctagaatatgccaagcatcaccccaaactcagc
cgagaggtggtttgttcgggactcaacgcttgtttctacatctgtctttttgccggcgtt
tgttttctcatcaacctgtcgatggatcgctattgcgtcattgtctggggtgtagaattg
aaccgcgttcgaaataacaagcgggctacctgttgggtggtgattttttggatactggcc
gcgctcatggggatgccacactacctgatgtacagtcataccaataacgagtgtgttggt
gaatttgctaacgagacttcaggttggttccccgtctttttgaacaccaaagtcaacatt
tgcggctacctggcgcccatcgtgctgatggcgtacacgtacaaccgtatggtgcggttt
atcattaactacgtgggtaaatggcacatgcagacgctccacgttcttttagttgtggtt
gtatcttttgccagcttttggttccccttcaatctggcactatttttagaatccatccgt
cttttatcgggaacgcaaaacgagactctccaaaccgttattactttctgtctatacgtc
ggtcagtttttggcctacgttcgcgcttgtctgaatcctgggatctacatcctagtaggc
actcaaatgaggaaggacatgtggacaaccctaagggtattcgcctgttgctgcgtgaag
caggagataccttaccaggacattgatattgagctacaaaaggacatacaaagaagggcc
aaacacaccaaacgtacccattatgacagaaaacatgcacctatggagtccggggaggag
gaatttctgttgtaa

DBGET integrated database retrieval system