KEGG   Viruses: 3119775
Entry
3119775           CDS       T40000                                 
Symbol
N, PPRVgp1
Name
(RefSeq) Peste des petits ruminants virus; nucleocapsid protein
  KO
K19380  Morbillivirus nucleoprotein
Taxonomy
  Lineage
Viruses; -ssRNA viruses; Riboviria; Orthornavirae; Negarnaviricota; Haploviricotina; Monjiviricetes; Mononegavirales; Paramyxoviridae; Orthoparamyxovirinae; Morbillivirus; Small ruminant morbillivirus
Organism
vg  Viruses (Small ruminant morbillivirus)
SSDB
Motif
Pfam: Paramyxo_ncap Ebola_NP
Other DBs
NCBI-GeneID: 3119775
NCBI-ProteinID: YP_133821
RS: NC_006383
UniProt: Q5ZER8
LinkDB
Position
NC_006383:108..1685
AA seq 525 aa
MATLLKSLALFKRNKDKAPTASGSGGAIRGIKNVIIVPIPGDSSIITRSRLLDRLVRLAG
DPDINGSKLTGVMISMLSLFVESPGQLIQRITDDPDVSIRLVEVVQSTRSQSGLTFASRG
ADLDNEADMYFSTEGPSSGGKKRINWFENREIIDIEVQDPEEFNMLLASILAQVWILLAK
AVTAPDTAADSELRRWVKYTQQRRVIGEFRLDKGWLDAVRNRIAEDLSLRRFMVSLILDI
KRTPGNKPRIAEMICDIDNYIVEAGLASFILTIKFGIETMYPALGLHEFAGELSTIESLM
NLYQQLGEVAPYMVILENSIQNKFSAGAYPLLWSYAMGVGVGLENSMGGLNFGRSYFDPA
YFRLGQEMVRRSAGKVSSVIAAELGITAEEAKLVSEIASQAGDERTARGTGPRQAQVSFL
QHKTGEGESSAPATREGVKAAIPNGSEERDRKQTRSGRPRGETPSQLLLEIMPEDEVSRE
SGQNPREAQRSAEALFRLQAMAKILEDQEEGEDNSQVYNDKDLLG
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggcgactcttcttaaaagcttagcattgttcaagaggaacaaagacaaagcgccgacg
gcatcaggttcaggaggggccatccgggggattaagaatgttatcatagtcccgattccc
ggagactcgtccatcattacccgttcaagactgctcgacaggcttgtcagattggccgga
gatcctgacatcaacgggtcaaagttaaccggcgtgatgatcagcatgttatctttgttc
gtagagtcacccgggcaattgatacagcgaatcacagatgatccagatgttagtatccgc
cttgttgaggtagttcaaagtactaggtctcagtccgggttgacctttgcatcacgtggt
gctgatttagacaacgaggcagacatgtatttttcaactgaggggccctcgagtggaggt
aagaaaaggatcaactggtttgagaacagagaaataatagacatagaagtgcaggatcca
gaagagttcaatatgttgttagcctccatactagcacaagtctggatccttctggccaag
gctgttacggcaccggatacggcagctgactcagaattgagaaggtgggttaaatataca
caacaaaggagagtgattggggaatttcgccttgacaaagggtggctggacgcagtccgc
aacagaattgcagaagatctatcacttcggcggttcatggtatctctcatacttgacatc
aagaggacccccggcaacaagccaaggattgcagaaatgatctgcgacattgacaactat
attgtcgaagccggactcgccagtttcatccttactatcaagtttggtatcgaaaccatg
tatcctgcattagggctccacgagtttgccggggaattgtccactattgaatccttgatg
aacttgtatcaacagctaggagaggttgcaccctacatggtaattctcgagaactcaatt
cagaacaagtttagtgcaggagcttatcccctcctctggagctatgcgatgggtgtcgga
gttgggctggagaactcaatggggggcttgaactttggcaggtcatattttgaccctgcc
tattttcgtctcggacaggagatggtcagaagatctgcaggaaaggtcagctctgtgatt
gcggccgagctcggcatcacagcagaggaagccaaactagtctcggaaatcgcctcgcag
gctggggacgaaagaaccgctagagggactgggcctcgacaggcgcaggtctccttcctc
cagcacaaaacaggagagggagagtcgtccgcaccagcaaccagagagggggtcaaagct
gcgatcccaaacggatccgaagaaagggacaggaagcaaacacgctcaggaaggcccaga
ggagagacccccagccaactgctcctggaaatcatgccagaggatgaggtctcgcgagag
tctggtcaaaaccctcgtgaggctcaaagatcggccgaggcactcttcaggctgcaggcc
atggccaagattctggaggaccaggaggagggagaagacaacagtcaggtctacaacgac
aaggatctcctcggctaa

DBGET integrated database retrieval system