KEGG   Viruses: 3850227
Entry
3850227           CDS       T40000                                 

Symbol
UL44, CeHV16_gp46
Name
(RefSeq) Papiine alphaherpesvirus 2; envelope glycoprotein C
  KO
K19256  Simplexvirus envelope glycoprotein C
Taxonomy
TAX:340907
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Simplexvirus
Organism
vg  Viruses (Papiine alphaherpesvirus 2)
SSDB
Motif
Pfam: Marek_A C1-set
Other DBs
NCBI-GeneID: 3850227
NCBI-ProteinID: YP_443891
RS: NC_007653
UniProt: Q2QBD2
LinkDB
Position
NC_007653:96416..97804
AA seq 462 aa
MAGWRAAGLGLLMLTWLLCAGAGAPRGGAEGTTRAVAPSRGRGNGTRPGGGSPARAPGSA
PAPFRCKRPDVVALFGGRVAMGCRVPRPTADFRLRIWRVAAPRAEAGRPEPAEPGAVLVN
VTAPPPDGELVYDSAPGATGARVRWAEGAGPDARPRVYALEGTFPTLRLVIQELTLARQG
WYFWARGPADQPLRYGTWTRVRMLRRPSLSIRPHAVLEGEPFGATCVAANYYPGDRAAFR
WFEGGDEVAAPDRVRTRVDAQRDGFSATSTLTSEARAGLAPPRNLTCEFTWHRDAVSFSR
RNATGAPTVLPRPTIEMEFGGDEAVCTAACVPEGVALQWLLGADPAPAGNAVASGGPCPG
RPGLARLRSALPLSREHSEYTCRLVGYPATVPVLEHHGRREPPPRDPVGQQVTTALEWAG
IATGAVAAIGLAVGVGVCARRALERRRRGRAGRRPGDAARRG
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggccgggtggcgcgccgcgggcctgggcctgctgatgctgacgtggttgttgtgcgcg
ggcgccggcgcgcctcggggcggcgccgaggggacgacccgcgccgtcgcgccctcgcgc
gggcggggcaacggcacccggcccggggggggctcgccggcgcgggcgcccggctccgcg
cccgccccgttccgctgcaagcgccccgacgtggtcgcgctgttcggcggccgcgtggcg
atggggtgccgcgtgccgcgtcccaccgccgacttccgcctgcggatctggcgggtcgcg
gcgccgcgggcggaagccggccgccccgagcccgccgaacccggggcggtgctggtgaac
gtgaccgcccccccgcccgacggggagctggtctacgacagcgcccccggtgcgaccggg
gcgcgggtgcggtgggccgagggggcgggccccgatgcccgcccccgggtctacgcgctc
gaggggaccttcccgacgctgcggctcgtcatccaggagctcacgctcgcgcgccagggg
tggtacttctgggcccggggccccgccgaccagcccctccgctacggaacctggacgcgc
gtgcgcatgctccgccggccctccctctcgatccgcccgcacgcggttctcgagggcgag
ccgttcggggccacctgcgtggccgccaactactacccgggcgaccgcgccgccttccgc
tggttcgagggcggcgacgaggtggccgcgccggaccgggtgcgcacgcgcgtggacgcg
cagcgcgacggcttctcggccacctcgaccctgacgtcggaggcgcgggcgggcctggcg
cccccgcgcaacctgacctgcgagttcacctggcaccgcgacgcggtgtccttctcgcgg
cgaaacgccaccggcgccccgacggtgctgccgcggccgaccatcgagatggagttcggg
ggcgacgaggccgtctgcacggcggcctgcgtccccgagggggtcgcgctgcagtggctg
ctgggcgccgaccccgcgcccgcggggaacgccgtcgcctccggcgggccctgccccggg
cgccccggcctcgcccgactgcgctccgccctgccgctgtcgcgcgagcacagcgagtac
acctgccggctcgtcggctaccccgcgaccgtccccgtgctggagcaccacggccgccgc
gagccaccgccccgtgaccccgtgggccagcaggtgaccaccgcgctcgagtgggccggc
atcgccaccggggccgtggccgcgatcgggctcgccgtgggcgtcggcgtctgcgcgcgc
cgcgccctcgagaggaggcgccggggccgcgccgggcggcggccgggcgacgccgcccgg
agagggtga

DBGET integrated database retrieval system