KEGG   Viruses: 43740572
Entry
43740572          CDS       T40000                                 

Gene name
ORF6, GU280_gp06
Definition
(RefSeq) Severe acute respiratory syndrome coronavirus 2; ORF6 protein
  KO
K24580  SARS coronavirus accessory protein 6
Taxonomy
TAX:2697049 [GN:T40361]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Sarbecovirus; Severe acute respiratory syndrome-related coronavirus
Organism
vg  Viruses (Severe acute respiratory syndrome-related coronavirus)
SSDB
Motif
Pfam: bCoV_NS6
Other DBs
NCBI-GeneID: 43740572
NCBI-ProteinID: YP_009724394
RS: NC_045512
UniProt: P0DTC6
LinkDB
Position
NC_045512:27202..27387
AA seq 61 aa
MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEI
D
NT seq 186 nt   +upstreamnt  +downstreamnt
atgtttcatctcgttgactttcaggttactatagcagagatattactaattattatgagg
acttttaaagtttccatttggaatcttgattacatcataaacctcataattaaaaattta
tctaagtcactaactgagaataaatattctcaattagatgaagagcaaccaatggagatt
gattaa

DBGET integrated database retrieval system