KEGG   Viruses: 43740574
Entry
43740574          CDS       T40000                                 

Gene name
ORF7b, GU280_gp08
Definition
(RefSeq) Severe acute respiratory syndrome coronavirus 2; ORF7b
  KO
K24582  SARS coronavirus accessory protein 7b
Taxonomy
TAX:2697049 [GN:T40361]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Sarbecovirus; Severe acute respiratory syndrome-related coronavirus
Organism
vg  Viruses (Severe acute respiratory syndrome-related coronavirus)
SSDB
Motif
Pfam: bCoV_NS7B Baculo_11_kDa FtsX Adipogenin
Other DBs
NCBI-GeneID: 43740574
NCBI-ProteinID: YP_009725318
RS: NC_045512
UniProt: P0DTD8
LinkDB
Position
NC_045512:27756..27887
AA seq 43 aa
MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA
NT seq 132 nt   +upstreamnt  +downstreamnt
atgattgaactttcattaattgacttctatttgtgctttttagcctttctgctattcctt
gttttaattatgcttattatcttttggttctcacttgaactgcaagatcataatgaaact
tgtcacgcctaa

DBGET integrated database retrieval system