KEGG   Viruses: 43740576
Entry
43740576          CDS       T40000                                 
Symbol
ORF10, GU280_gp11
Name
(RefSeq) Severe acute respiratory syndrome coronavirus 2; ORF10 protein
  KO
K24584  SARS coronavirus accessory protein 10
Virus
2697049  Severe acute respiratory syndrome coronavirus 2
SSDB
Other DBs
NCBI-GeneID: 43740576
NCBI-ProteinID: YP_009725255
RS: NC_045512
UniProt: A0A663DJA2
LinkDB
Position
NC_045512:29558..29674
AA seq 38 aa
MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT
NT seq 117 nt   +upstreamnt  +downstreamnt
atgggctatataaacgttttcgcttttccgtttacgatatatagtctactcttgtgcaga
atgaattctcgtaactacatagcacaagtagatgtagttaactttaatctcacatag

DBGET integrated database retrieval system