KEGG   Viruses: 4961447
Entry
4961447           CDS       T40000                                 

Gene name
ORF16, HHV8GK18_gp19
Definition
(RefSeq) Human gammaherpesvirus 8; ORF16
  KO
K21660  KSHV apoptosis regulator BCL2 homolog
Taxonomy
TAX:37296 [GN:T40081]
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Gammaherpesvirinae; Rhadinovirus
Organism
vg  Viruses (Human gammaherpesvirus 8)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 4961447
NCBI-ProteinID: YP_001129368
RS: NC_009333
UniProt: F5HGJ3 Q76RI8
LinkDB
Structure
PDB: 
1K3K

Position
NC_009333:30242..30769
AA seq 175 aa
MDEDVLPGEVLAIEGIFMACGLNEPEYLYHPLLSPIKLYITGLMRDKESLFEAMLANVRF
HSTTGINQLGLSMLQVSGDGNMNWGRALAILTFGSFVAQKLSNEPHLRDFALAVLPVYAY
EAIGPQWFRARGGWRGLKAYCTQVLTRRRGRRMTALLGSIALLATILAAVAMSRR
NT seq 528 nt   +upstreamnt  +downstreamnt
atggacgaggacgttttgcctggagaggtgttggccattgaagggatattcatggcctgt
ggattaaacgaacctgagtacctgtaccatcctttgctcagccctattaagctatacatc
acaggcttaatgcgagacaaggagtctttattcgaggccatgttggctaatgtgagattt
cacagcaccaccggtataaaccagcttgggttgagcatgctgcaggttagcggcgatgga
aacatgaactgggggcgagccctggctatactgacctttggcagttttgtggcccagaag
ttatccaacgaacctcacctgcgagactttgctttggccgttttacctgtatatgcgtat
gaagcaatcggaccccagtggtttcgcgctcgcggaggctggcgaggcctgaaggcgtat
tgtacacaggtgcttaccagaagaaggggacggagaatgacagcgctattgggaagcatt
gcattattggccactatattggcagcggtcgcgatgagcaggagataa

DBGET integrated database retrieval system