KEGG   Viruses: 4961471
Entry
4961471           CDS       T40000                                 
Symbol
HHV8GK18_gp82
Name
(RefSeq) Human gammaherpesvirus 8; ORF72
  KO
K21663  KSHV cyclin homolog
Taxonomy
TAX:37296 [GN:T40081]
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae/Gammaherpesvirinae; Rhadinovirus
Organism
37296  Viruses (Human gammaherpesvirus 8)
SSDB
Motif
Pfam: K-cyclin_vir_C Cyclin_N Herp-Cyclin Tmemb_185A NIL
Other DBs
NCBI-GeneID: 4961471
NCBI-ProteinID: YP_001129430
RS: NC_009333
UniProt: Q77Q36 F5HC81
LinkDB
Position
NC_009333:complement(123042..123815)
AA seq 257 aa
MATANNPPSGLLDPTLCEDRIFYNILEIEPRFLTSDSVFGTFQQSLTSHMRKLLGTWMFS
VCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRSLTPISTSSLCY
AAADSFSRQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLLGGSQHLDFWHHEVNTLI
TKALVDPKTGSLPASIISAAGCALLVPANVIPQDTHSGGVVPQLASILGCDVSVLQAAVE
QILTSVSDFDLRILDSY
NT seq 774 nt   +upstreamnt  +downstreamnt
atggcaactgccaataacccgccctcgggacttctggatcccacgctatgtgaggatcgg
atcttttacaatattcttgaaattgagccgcgctttttaacttctgactctgtatttggg
acctttcaacaatctcttacttcgcatatgcgtaagttactgggcacatggatgttttca
gtttgccaggaatacaacctagaacctaacgtggtcgcgttggcccttaatcttttggac
agactcctacttataaagcaggtgtccaaagaacactttcaaaagacagggagcgcctgc
ctgttagtggccagtaagctcagaagcctcacgcctatttctaccagttcactttgctat
gccgcggcagactccttttcccgccaagaacttatagaccaggagaaagaactccttgag
aagttggcgtggcgaacagaggcagtcttagcgacggacgtcacttccttcttgttactt
aaattgctggggggctcccaacacctggacttttggcaccacgaggtcaacaccctgatt
acaaaagccttagttgacccaaagactggctcattgcccgcctctattatcagcgctgca
ggctgtgcgctgttggttcctgccaacgtcattccgcaggatacccactcgggtggggta
gttcctcagctggcaagcatattgggatgcgatgtttccgttctacaggcggcagtggaa
cagatcctaacatctgtttcggactttgatctgcgcattctggacagctattaa

DBGET integrated database retrieval system