KEGG   Viruses: 80514753
Entry
80514753          CDS       T40000                                 
Symbol
QJ851_gp0296
Name
(RefSeq) Bodo saltans virus; hypothetical protein
Virus
2024608  Bodo saltans virus
SSDB
Other DBs
NCBI-GeneID: 80514753
NCBI-ProteinID: YP_010778135
RS: NC_075036
LinkDB
Position
NC_075036:321405..321653
AA seq 82 aa
MGTPTPAANPPGKATPPALGFIPTCPSELTLTPELPPDAAFPANVAANEFMFFDKVIVIY
CILFVDIVIMLYLSSISIFNFF
NT seq 249 nt   +upstreamnt  +downstreamnt
atgggaacaccaacacccgcagcaaatccaccaggaaaagcaacaccacctgcacttgga
ttcataccgacttgtccaagcgaattgacacttactcctgaattgccacctgatgcggcg
tttcctgcgaatgttgcagcaaatgaattcatgttttttgataaagtgattgtaatttat
tgtattttatttgttgatattgttataatgttatatctttcaagcatttcgattttcaat
tttttttga

DBGET integrated database retrieval system