KEGG   Viruses: 935604
Entry
935604            CDS       T40000                                 

Gene name
US27, CCMVgp157
Definition
(RefSeq) Panine betaherpesvirus 2; envelope glycoprotein US27
  KO
K22783  HCMV envelope glycoprotein US27
Taxonomy
TAX:188763
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Panine betaherpesvirus 2)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 935604
NCBI-ProteinID: NP_612799
RS: NC_003521
UniProt: Q8QRT3
LinkDB
Position
NC_003521:229954..231021
AA seq 355 aa
MSNNTTSRIPPKIYNTTLYQLYDYTRTWVWVIGFMGILLNLCVILTIVIKRRKKKSPSDV
YLCNIALADLALVFILPTILEYVHNHKDTAHHVACYAMNACFYICLFANVCFWTNLFMDR
YSAIVWGVQLNSIRNRRRSMWWSLMFWLFALIMASPHYALKQRSDSECVGDYSHDLTKVV
FPVFINFKVNILGFLVPIIVMSLAYHNMVRFVINYVGRWNLQTLDVLLVIVVSFGCFWFP
FNLALFLESIELMWSSTSRFLGGAIELCLHLGHFFVYFRACFNPLIYIIVGKQMSKDMCD
TFRSMCLCCYPRTVPYQDIDLEVKKDFQRRLKDSKKASYHGKNDKVPVEDTEFLL
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgtccaacaacaccaccagccgcattccgccgaagatctacaacactacattgtatcag
ctgtacgattataccagaacgtgggtatgggtcataggattcatggggattttgttgaat
ttatgtgtgattctcaccatcgtaatcaaacgtcgaaaaaagaagtctcctagcgacgtc
tatctttgcaacatcgctttagcggacttggcgctcgtgtttattctgcctaccatactc
gaatatgtgcacaatcataaggacaccgcacatcatgtggcttgttatgctatgaatgct
tgtttttacatatgtcttttcgcaaatgtatgcttttggactaacttgtttatggaccgc
tactccgctatcgtgtggggtgtacaactcaatagcatccgaaatcgccgtcgctctatg
tggtggagccttatgttctggctctttgccctgataatggcatctcctcactacgctctg
aaacaaagaagcgacagtgaatgtgtaggagactacagtcatgacctaactaaggtcgtt
ttccctgtgtttatcaatttcaaagtgaatatcctcggttttctagttcccatcatcgtt
atgtcgctcgcttatcacaatatggtccgttttgtgattaactacgtaggtagatggaac
ttacagactcttgatgtactcctggtgattgtggtatctttcggctgcttctggtttccc
ttcaatttggcactgtttctggagtctattgaactaatgtggagcagtacctctaggttt
ttaggaggtgctatcgagctttgtctccacctaggccattttttcgtgtattttcgcgcc
tgctttaacccactgatctatatcatcgtgggcaaacagatgtctaaggacatgtgtgat
acctttagatctatgtgcttatgttgttatccccgaacggtgccctaccaggacatcgac
ctcgaggtgaaaaaagactttcagagacggctcaaagatagcaaaaaggcctcctatcac
ggtaagaacgataaggtcccggtggaagacacagaattcctgctgtaa

DBGET integrated database retrieval system