KEGG   Viruses: 944684
Entry
944684            CDS       T40000                                 

Symbol
SPPV_03
Name
(RefSeq) Sheeppox virus; IL-10
  KO
K21533  EBV viral interleukin 10
Taxonomy
TAX:10266
  Lineage
Viruses; dsDNA viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota; Pokkesviricetes; Chitovirales; Poxviridae; Chordopoxvirinae; Capripoxvirus
Organism
vg  Viruses (Sheeppox virus)
SSDB
Motif
Pfam: IL10 IL22 Snapin_Pallidin PHTB1_C RPW8 Tektin DUF3496
Other DBs
NCBI-GeneID: 944684
NCBI-ProteinID: NP_659579
RS: NC_004002
UniProt: A0A2H4ETU0 A0A3F2YKG4
LinkDB
Position
NC_004002:2243..2749
AA seq 168 aa
MKTNTKIILFCYVILYLFSCTVASAKKCDDVSFDYILKDLRSEFSKIKSFVQNNDKENMM
LLSQSMLDKLTSCIGCKSLSDMIKFYLNDVLPNAEKIEHIKNKITSIGEKLKSLKEKLIS
CDFLHCENHDEIKAVKTIFNKLKDKGIYKAMGEFDIFINHLEKYIVKK
NT seq 507 nt   +upstreamnt  +downstreamnt
atgaaaacaaacacaaaaataatactattttgttatgttattctttatctatttagttgt
acagtagcatctgctaaaaaatgtgacgacgttagctttgattacatattaaaagattta
cgttcagaatttagcaaaataaaaagttttgttcaaaacaatgataaagaaaatatgatg
ctattaagtcaatcaatgttagacaagttgactagttgcataggatgtaaatctttatcg
gatatgataaaattttatttaaatgatgttttaccaaatgcagaaaaaatagaacacata
aaaaataaaataacttcaataggagaaaagttaaaatcgttaaaagaaaaactaatatca
tgtgattttttacattgtgaaaatcatgacgaaataaaagcagttaaaacaatttttaac
aaattaaaagataaaggtatttataaggctatgggagagtttgatatttttattaatcac
ttagaaaagtacatagttaaaaagtaa

DBGET integrated database retrieval system