KEGG   Viruses: 9714828
Entry
9714828           CDS       T40000                                 

Symbol
ORF6, BtCoVBM48_gp6
Name
(RefSeq) Bat coronavirus BM48-31/BGR/2008; ORF6 protein
  KO
K24580  SARS coronavirus accessory protein 6
Taxonomy
TAX:864596 [GN:T40376]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Sarbecovirus; unclassified Sarbecovirus
Organism
vg  Viruses (Bat coronavirus BM48-31/BGR/2008)
SSDB
Motif
Pfam: bCoV_NS6
Other DBs
NCBI-GeneID: 9714828
NCBI-ProteinID: YP_003858588
RS: NC_014470
UniProt: E0XIZ7
LinkDB
Position
NC_014470:26993..27181
AA seq 62 aa
MFSLVAFQVTVAELLILIMKSFGLALTHIQIGIVSLLKILTNRLDRRYSKLDEEEPMEID
HP
NT seq 189 nt   +upstreamnt  +downstreamnt
atgtttagtctagttgctttccaagttaccgtagcagagttgttaattttaattatgaaa
tcttttggattggcacttactcatatccaaattggtatagtttcattattaaaaatccta
acaaaccgtctagatagaaggtattctaaactagacgaagaagaacctatggaaattgat
catccttaa

DBGET integrated database retrieval system