Viruses: 9924623
Help
Entry
9924623 CDS
T40000
Symbol
R40, MIMI_gp0048
Name
(RefSeq) Acanthamoeba polyphaga mimivirus; hypothetical protein
Virus
212035
Acanthamoeba polyphaga mimivirus
Taxonomy
SSDB
Ortholog
Paralog
GFIT
VOG
VOG cluster
Other DBs
NCBI-GeneID:
9924623
NCBI-ProteinID:
YP_003986522
RS:
NC_014649
UniProt:
Q5UPC1
E3VXR1
LinkDB
All DBs
Position
NC_014649:50750..51055
Genome browser
AA seq
101 aa
AA seq
DB search
MENNNFRDSVLAILVCQFIGPNVFIIIGSIGSVIGVKIMEMYPHYCENHGIYIDKTSVGI
AHGIYGIILGFIGIYVFLFVLLFILSIIFSIIYVISKRLSS
NT seq
306 nt
NT seq
+upstream
nt +downstream
nt
atggaaaataataattttagagattctgtattggcaatcttagtttgtcaattcattggt
cccaatgtatttattattattggatcaatcggttctgtcattggtgtaaaaatcatggaa
atgtatccacattattgtgaaaatcatggaatatatatcgataaaactagtgttggtatc
gcgcatggtatttatggtataattttaggatttattggtatttatgtttttttgtttgtt
ctattgtttatcctatcaattatattttccataatttatgtcatttccaaaagattgtca
agttag
DBGET
integrated database retrieval system