Viruses: 9924652
Help
Entry
9924652 CDS
T40000
Symbol
R61c, MIMI_gp0075
Name
(RefSeq) Acanthamoeba polyphaga mimivirus; hypothetical protein
Virus
212035
Acanthamoeba polyphaga mimivirus
Taxonomy
SSDB
Ortholog
Paralog
GFIT
VOG
VOG cluster
Other DBs
NCBI-GeneID:
9924652
NCBI-ProteinID:
YP_003986549
RS:
NC_014649
UniProt:
E3VXZ1
LinkDB
All DBs
Position
NC_014649:73136..73261
Genome browser
AA seq
41 aa
AA seq
DB search
MPKKQQTQSGGSSGNSGINYHAKYLKYKKKYLDLKSKKYHS
NT seq
126 nt
NT seq
+upstream
nt +downstream
nt
atgcccaaaaaacagcaaacccaaagtggtggttctagtggtaattctggcatcaattat
cacgcaaaatacctaaaatacaaaaagaaatatctcgatttgaaatccaaaaaatatcat
tcataa
DBGET
integrated database retrieval system