Vibrio gazogenes: BSQ33_15335 Help Entry BSQ33_15335       CDS       T04933                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism vga  Vibrio gazogenes Pathway vga00261   Monobactam biosynthesis vga01100   Metabolic pathways vga01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vga00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BSQ33_15335  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:vga01008]     BSQ33_15335 Polyketide biosynthesis proteins [BR:vga01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BSQ33_15335 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ASA56934 UniProt:  A0A1Z2SIC1 LinkDB All DBs Position 1:3370763..3370957 Genome browser AA seq 64 aa AA seqDB search MAEQYVNPFDDPENQFIVLINHHGQYSLWPEFKQTPSGWKQTFGPSGKQDCIEHIEANWQ DIRV NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atggcagaacaatacgtgaatccttttgatgatcctgaaaatcagttcatcgtcctgatc aaccatcacggtcaatacagcttgtggcctgagtttaaacagacgccttcgggctggaaa cagacttttggcccgtccggtaaacaggattgtatcgaacacattgaagcaaactggcaa gacatccgagtgtaa

DBGET integrated database retrieval system