Vibrio gigantis: MID13_03850 Help Entry MID13_03850       CDS       T08202                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vgi  Vibrio gigantis Pathway vgi01100   Metabolic pathways vgi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vgi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MID13_03850    00074 Mycolic acid biosynthesis     MID13_03850   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MID13_03850 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD Motif Other DBs NCBI-ProteinID:  ULN64945 LinkDB All DBs Position 1:complement(844718..844975) Genome browser AA seq 85 aa AA seqDB search MTQANQQEVYNQVKDALIELFELDAEDITPEAHLYLDLDLDSIDAVDLVVHLQNVTGKKI KPEEFKAVRTVNDVVESVVELLKDA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgacacaagctaaccaacaagaagtatacaaccaggttaaagatgcgctgattgagctg ttcgagcttgatgctgaagatatcactccggaagctcatctctatcttgatctagaccta gacagcattgatgcggttgatttagtcgttcacctccagaacgtaacaggtaaaaagatc aaacctgaagagttcaaagcagtacgcaccgttaatgacgttgtagagtctgtggttgaa ctattgaaggacgcataa

DBGET integrated database retrieval system