Vibrio gigantis: MID13_10475 Help Entry MID13_10475       CDS       T08202                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vgi  Vibrio gigantis Pathway vgi01100   Metabolic pathways vgi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vgi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MID13_10475 (acpP)    00074 Mycolic acid biosynthesis     MID13_10475 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MID13_10475 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 EutQ Motif Other DBs NCBI-ProteinID:  ULN63354 LinkDB All DBs Position 1:complement(2365297..2365530) Genome browser AA seq 77 aa AA seqDB search MSNLEERVKKIIVEQLGVDEAEVKNEASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVTSAQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaacctcgaagaacgcgtaaagaaaatcattgttgaacagctaggtgtagacgaa gctgaagttaaaaacgaagcttctttcgttgatgacctaggtgcagattctctagacaca gttgagctagtaatggctctagaagaagaattcgacactgaaatcccagatgaagaagct gagaaaattactactgttcaagcagctatcgattacgtaactagcgctcagtaa

DBGET integrated database retrieval system