Vallitalea guaymasensis: HYG85_16615 Help Entry HYG85_16615       CDS       T07172                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism vgu  Vallitalea guaymasensis Pathway vgu00020   Citrate cycle (TCA cycle) vgu00720   Other carbon fixation pathways vgu01100   Metabolic pathways vgu01110   Biosynthesis of secondary metabolites vgu01120   Microbial metabolism in diverse environments vgu01200   Carbon metabolism vgu01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:vgu00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     HYG85_16615   09102 Energy metabolism    00720 Other carbon fixation pathways     HYG85_16615 Enzymes [BR:vgu01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      HYG85_16615 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_6 Fer4_7 Fer4 Fer4_2 Fer4_10 Fer4_21 Fer4_9 Fer4_15 Fer4_8 Fer4_22 Fer4_4 Fer4_17 Fer4_16 Fer4_13 Fer4_3 Fer4_18 Motif Other DBs NCBI-ProteinID:  QUH30440 UniProt:  A0A8J8MD24 LinkDB All DBs Position 3891672..3891878 Genome browser AA seq 68 aa AA seqDB search MAKVTFNEELCKGCGLCTTVCPKKIVVLSKDKINSKGYHPATVTDMDQCIGCAFCATICP DVVIKVEK NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggcaaaggtaacttttaatgaggagttatgtaagggatgtgggttatgtaccacagta tgtcctaaaaagatagtggttttatcaaaagataagattaattcaaaaggatatcatcct gccactgttacagacatggatcaatgtattggttgtgcattttgtgctaccatttgtcct gatgtcgtcattaaagtagagaaataa

DBGET integrated database retrieval system