Vibrio campbellii ATCC BAA-1116: VIBHAR_00674 Help Entry VIBHAR_00674      CDS       T00589                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism vha  Vibrio campbellii ATCC BAA-1116 Pathway vha01100   Metabolic pathways vha01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vha00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VIBHAR_00674    00074 Mycolic acid biosynthesis     VIBHAR_00674   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VIBHAR_00674 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ABU69676 UniProt:  A7MSN2 LinkDB All DBs Position I:658930..659136 Genome browser AA seq 68 aa AA seqDB search MNEGQVIELVKEVLVSDLDEITLETELNEDNWDSLAVVTFIALVNEKYDVVFPADKAIMA ETVKDLLI NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaacgaagggcaagtaatcgaattagtaaaagaagtactggtttcagatttagacgaa attactctagaaactgagttaaatgaagataactgggattcattagcagttgttaccttt attgctttggtaaatgaaaagtatgatgtggtttttccagcggataaagcaattatggca gaaacagttaaagatttattgatctag

DBGET integrated database retrieval system