Vibrio campbellii ATCC BAA-1116: VIBHAR_01604 Help Entry VIBHAR_01604      CDS       T00589                                  Name (GenBank) hypothetical protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism vha  Vibrio campbellii ATCC BAA-1116 Pathway vha00190   Oxidative phosphorylation vha01100   Metabolic pathways vha02020   Two-component system Module vha_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:vha00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     VIBHAR_01604  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     VIBHAR_01604 Enzymes [BR:vha01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      VIBHAR_01604 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ABU70574 UniProt:  A7N1I3 LinkDB All DBs Position I:1617158..1617265 Genome browser AA seq 35 aa AA seqDB search MWYFAWILGVLLACAFGIINALWLEHSEMMDKDSE NT seq 108 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggattctaggtgtactacttgcttgtgcattcggtatcatcaac gctctttggttagagcactcagaaatgatggataaagacagtgagtaa

DBGET integrated database retrieval system