Vibrio harveyi: AL538_14095 Help Entry AL538_14095       CDS       T04380                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vhr  Vibrio harveyi Pathway vhr01100   Metabolic pathways vhr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vhr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AL538_14095    00074 Mycolic acid biosynthesis     AL538_14095   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AL538_14095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AMF98764 LinkDB All DBs Position 1:complement(2984796..2985053) Genome browser AA seq 85 aa AA seqDB search MTDVNKDQVFEQVKDALVELFEIEAEDIQPEAHLYTDLDLDSIDAVDLVVHLQNATGKKI KPAEFSTVRTVDDVVNAVTELLKES NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgacagacgtaaataaagatcaagtatttgaacaagttaaagatgcgcttgtggagcta ttcgaaatcgaagctgaagacattcagccagaagcccatctttacaccgatctagaccta gacagcattgatgccgtagaccttgttgtacacctacaaaatgccactggcaaaaagatc aaaccagcggaattcagcacagttcgtactgtcgatgacgtggttaatgcagtaactgaa cttctcaaggaaagttaa

DBGET integrated database retrieval system