Vibrio sp. STUT-A11: VspSTUT11_09630 Help Entry VspSTUT11_09630   CDS       T10419                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vib  Vibrio sp. STUT-A11 Pathway vib01100   Metabolic pathways vib01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vib00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VspSTUT11_09630 (acpP)    00074 Mycolic acid biosynthesis     VspSTUT11_09630 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VspSTUT11_09630 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 EutQ Motif Other DBs NCBI-ProteinID:  BDR12987 LinkDB All DBs Position 1:1111966..1112199 Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKIIVEQLGVDEAEVKNEASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVNSAQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgcgtaaagaaaatcattgttgaacagctaggtgtagacgaa gcagaagttaaaaacgaagcttctttcgttgacgatctaggtgctgattctctagacact gtagaactagttatggctctagaagaggaattcgacactgagattcctgacgaagaagct gagaagatcactactgttcaagctgcaatcgactacgtaaacagcgctcagtaa

DBGET integrated database retrieval system