Virgibacillus sp. MSP4-1: GWK91_06350 Help Entry GWK91_06350       CDS       T06398                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism vim  Virgibacillus sp. MSP4-1 Brite KEGG Orthology (KO) [BR:vim00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:vim03032]     GWK91_06350    03036 Chromosome and associated proteins [BR:vim03036]     GWK91_06350    03400 DNA repair and recombination proteins [BR:vim03400]     GWK91_06350 DNA replication proteins [BR:vim03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     GWK91_06350 Chromosome and associated proteins [BR:vim03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     GWK91_06350 DNA repair and recombination proteins [BR:vim03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       GWK91_06350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 DUF2267 Rpf1_C HU-CCDC81_euk_2 HU-DNA_bdg Glycos_trans_3N HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  QHS22591 UniProt:  A0A6B9YCX4 LinkDB All DBs Position complement(1229943..1230215) Genome browser AA seq 90 aa AA seqDB search MNKTELVNAVAEKGDLSKKDAAQAVDAVFESITDSLTDGDKVQLIGFGNFEVRERAARKG RNPQTGDEIEIPASKVPAFKPGKALKDAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaaacagaactcgtaaatgcagttgctgaaaaaggcgatctttctaaaaaggat gcagctcaggctgtagatgcagtatttgaatccattactgattccttaactgacggagat aaagtccagcttatcgggtttggtaactttgaggttcgcgagcgtgcggctcgtaaagga cgtaatccacaaactggtgatgagattgaaattccagccagcaaagtacctgcattcaaa cctggtaaagcccttaaggatgctgtgaaataa

DBGET integrated database retrieval system