Vulgatibacter incomptus: AKJ08_1783 Help Entry AKJ08_1783        CDS       T04035                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism vin  Vulgatibacter incomptus Pathway vin01100   Metabolic pathways vin01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vin00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AKJ08_1783    00074 Mycolic acid biosynthesis     AKJ08_1783   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AKJ08_1783 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AKU91396 UniProt:  A0A0K1PDB6 LinkDB All DBs Position 2120440..2120697 Genome browser AA seq 85 aa AA seqDB search MSPAEEEVLAEVRRIAAAELGWKTPIDPRHELVADLRLDSIGMLTVVQLLEDRFRIALAE GDEAEIRTVEELVRLVARRRAEADR NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagcccggcggaagaggaggtgctcgccgaggtgcggcggatcgcggcggcggagctc ggatggaagacgccgatcgatccccgccacgagctggtggcggacctgcgcctcgactcc atcgggatgctcaccgtcgtccagctcctcgaggatcggttccggatcgctctcgcggag ggcgacgaggcggagatccgcacggtcgaggagctggtccggctggtcgccaggcggcgg gcggaggcggatcgatga

DBGET integrated database retrieval system