Vitreoscilla sp. C1: ADP71_05220 Help Entry ADP71_05220       CDS       T05336                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism vit  Vitreoscilla sp. C1 Brite KEGG Orthology (KO) [BR:vit00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:vit03110]     ADP71_05220 Chaperones and folding catalysts [BR:vit03110]  Protein folding catalysts   Protein disulfide isomerase    ADP71_05220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Glrx-like DSBA Thioredoxin_3 Ribosomal_L5e GST_N_3 Motif Other DBs NCBI-ProteinID:  AUZ04306 UniProt:  A0A2L0PJD7 LinkDB All DBs Position 424054..424314 Genome browser AA seq 86 aa AA seqDB search MQKVTMYTSSYCPYCVMAKRLLAQYGVTEVEEVRIDRDAEQYAYMQEVTGLRSVPQIFIG ETHVGGFDSLNALNRAGQLATLLNGE NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcaaaaagtgaccatgtacacttcctcatattgtccatattgtgtgatggcaaaacgc ttattggcacaatatggcgtgactgaagtagaagaagtgagaattgatagagatgctgaa caatacgcatacatgcaagaagtcacaggcttacgcagtgtgccacagatttttatcggc gaaacccatgtgggtggatttgacagtttgaatgcgctcaatcgagcaggtcaattggcc accttattaaacggcgaatga

DBGET integrated database retrieval system