Varroa jacobsoni: 111265104 Help Entry 111265104         CDS       T07417                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism vja  Varroa jacobsoni Pathway vja04137   Mitophagy - animal vja04140   Autophagy - animal vja04144   Endocytosis vja04145   Phagosome vja04148   Efferocytosis Brite KEGG Orthology (KO) [BR:vja00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     111265104    04145 Phagosome     111265104    04140 Autophagy - animal     111265104    04137 Mitophagy - animal     111265104    04148 Efferocytosis     111265104  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vja04131]     111265104   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vja04147]     111265104    04031 GTP-binding proteins [BR:vja04031]     111265104 Membrane trafficking [BR:vja04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     111265104 Exosome [BR:vja04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111265104   Exosomal proteins of other body fluids (saliva and urine)    111265104   Exosomal proteins of colorectal cancer cells    111265104   Exosomal proteins of bladder cancer cells    111265104 GTP-binding proteins [BR:vja04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     111265104 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase ATP_bind_1 cobW AAA_22 nSTAND3 Septin AAA_16 NTPase_1 AAA_7 PduV-EutP AAA_24 SRPRB ABC_tran ATPase_2 NB-ARC NACHT MCM AAA_14 ATP-synt_ab AAA_5 Motif Other DBs NCBI-GeneID:  111265104 NCBI-ProteinID:  XP_022697231 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSSQYKATIGADFLTKEVMVDNKLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTSPTTFKSLESWRDEFLIQASPRDPENFPF VVIGNKIDLENRSIMQKRAQSWCQSKNSIPYFETSAKEALHVDEAFATVARNALAQETEV ELYNEFPDQIKLSPGLSGGVRQDNCGC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcccgaaagaaggtgcttcttaaagttatcatcctcggtgactctggtgtcggc aagacgtctcttatgaaccagtacgtgaacaagaaattctcgtcacaatataaagctacc atcggagcagatttcctaacaaaggaagttatggtcgacaacaaacttgtcaccatgcag atttgggatacggcaggacaggaacgattccagtctctcggagtggcattttatcgaggt gcagattgctgcgtgctcgtctatgatgtgacatctccaacgaccttcaaaagtcttgaa agctggcgcgatgagttccttattcaagcttcacccagagaccccgagaatttccccttc gtcgtcattggaaacaagatcgaccttgagaaccggtctatcatgcagaagcgcgcacag tcgtggtgtcaatcaaagaatagcattccctattttgaaacctcggccaaggaagcactt catgtcgacgaagcgttcgcaacggtggcacggaatgccctcgctcaggaaaccgaggtc gaactgtacaatgaattccctgatcaaattaaactgtcgcccgggctgtctggcggagtg cgccaggacaactgtggatgctag

DBGET integrated database retrieval system