Varroa jacobsoni: 111267903 Help Entry 111267903         CDS       T07417                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism vja  Varroa jacobsoni Pathway vja04145   Phagosome vja04148   Efferocytosis vja04310   Wnt signaling pathway vja04620   Toll-like receptor signaling pathway vja05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:vja00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     111267903  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     111267903    04148 Efferocytosis     111267903  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111267903  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     111267903  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vja04131]     111267903   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vja04147]     111267903    04031 GTP-binding proteins [BR:vja04031]     111267903 Membrane trafficking [BR:vja04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     111267903  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     111267903   Macropinocytosis    Ras GTPases     111267903  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     111267903 Exosome [BR:vja04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111267903   Exosomal proteins of other body fluids (saliva and urine)    111267903   Exosomal proteins of colorectal cancer cells    111267903   Exosomal proteins of bladder cancer cells    111267903 GTP-binding proteins [BR:vja04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     111267903 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  111267903 NCBI-ProteinID:  XP_022702212 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTA GQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVSHHGPNTPIILVGTKLDL RDDKDTLEKLRDRKLAPITYPQGLGMAKEITAVKYLECSALTQKGLKNVFDEAIRAVLCP PYKPTKKRKCVIL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgatgcaggcgataaagtgtgtcgttgtcggcgacggagccgttggtaagacgtgtctt ctgatttcctacaccacgaatgccttcccaggcgaatacatacctacggtattcgacaac tattctgcgaacgtgatggttgacgggaagcccattaatcttggactctgggatactgct ggtcaggaagactacgatcgactacgccccctatcatacccgcagacagatgtgttcctt atctgcttctcactagttaatcccgcatcgttcgaaaacgtccgtgcaaaatggtaccca gaagtcagccatcatggtcctaatacaccgatcattcttgtgggaaccaagcttgatctt cgagacgacaaagacacattggaaaagttgcgggaccgtaaactcgctccgatcacgtac ccgcagggtctcggaatggccaaagagatcacagctgtcaagtatctcgagtgttctgct ctgactcaaaagggcctgaagaacgtgttcgatgaagctatccgagccgtactctgcccg ccttataagccgacgaagaaaaggaagtgcgtgattctctag

DBGET integrated database retrieval system