Varanus komodoensis (Komodo dragon): 123023064 Help Entry 123023064         CDS       T07701                                  Name (RefSeq) histone H2A.Z   KO K11251   histone H2A Organism vko  Varanus komodoensis (Komodo dragon) Pathway vko03082   ATP-dependent chromatin remodeling vko04217   Necroptosis Brite KEGG Orthology (KO) [BR:vko00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     123023064  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     123023064  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vko03036]     123023064   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vko04147]     123023064 Chromosome and associated proteins [BR:vko03036]  Eukaryotic type   Nucleosome assembly factors    Histones     123023064 Exosome [BR:vko04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123023064 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  123023064 NCBI-ProteinID:  XP_044285357 Ensembl:  ENSVKKG00000009840 UniProt:  A0A8D2KYW6 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MAGGKAGKDSGKTKTKTVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTV NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggtggcaaagctggaaaggactctggaaagacgaagaccaagacagtgtcccgt tcacagagagctggcttacagttccctgttggccgtattcaccgacatcttaaatcaaga actaccagtcatggccgtgtgggggctacagctgctgtatatagtgctgctatcctggag tacctcacagctgaagttcttgaactagcaggaaatgcatccaaagacttgaaggtgaaa agaattactcctcgtcacttgcaacttgccataagaggtgatgaggaactagattcttta atcaaagcaacaattgctggtggaggtgtaattccacatattcataaatctctcattgga aagaaagggcagcagaaaacagtttaa

DBGET integrated database retrieval system