Varanus komodoensis (Komodo dragon): 123024042 Help Entry 123024042         CDS       T07701                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism vko  Varanus komodoensis (Komodo dragon) Pathway vko04081   Hormone signaling vko04144   Endocytosis vko04150   mTOR signaling pathway vko04270   Vascular smooth muscle contraction vko04310   Wnt signaling pathway vko04350   TGF-beta signaling pathway vko04510   Focal adhesion vko04520   Adherens junction vko04530   Tight junction vko04621   NOD-like receptor signaling pathway vko04625   C-type lectin receptor signaling pathway vko04810   Regulation of actin cytoskeleton vko05100   Bacterial invasion of epithelial cells vko05132   Salmonella infection Brite KEGG Orthology (KO) [BR:vko00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     123024042    04350 TGF-beta signaling pathway     123024042    04150 mTOR signaling pathway     123024042   09133 Signaling molecules and interaction    04081 Hormone signaling     123024042  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     123024042  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     123024042  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vko04131]     123024042   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vko04147]     123024042    04031 GTP-binding proteins [BR:vko04031]     123024042 Membrane trafficking [BR:vko04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     123024042 Exosome [BR:vko04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123024042   Exosomal proteins of other body fluids (saliva and urine)    123024042   Exosomal proteins of colorectal cancer cells    123024042   Exosomal proteins of bladder cancer cells    123024042 GTP-binding proteins [BR:vko04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     123024042 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  123024042 NCBI-ProteinID:  XP_044287239 Ensembl:  ENSVKKG00000008868 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYLECSAKTKDGVREVFEMATRAALQ AKRGRKKTSCQLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgcaatacgcaagaaacttgtcattgtgggggatggagcttgcggaaagacctgc cttcttattgtcttcagcaaggaccagttcccagaagtctatgtccccactgtctttgag aactatgtggctgacattgaggtggatggaaagcaggtggagctggctctgtgggataca gctggccaagaggactatgaccgcctgagacctctctcttacccagacacagatgtcatc ctcatgtgcttctctattgacagccctgatagtttagagaacatccctgagaagtggact ccagaggtgaaacacttttgtcccaatgtgcctatcatcctggtgggaaacaagaaagac ctgcgtaatgatgaacacacacgccgggagttagccaaaatgaagcaggaaccagtgaaa ccagaggagggtcgggacatggccaacaggattagtgcttttggctacctggagtgttct gccaagacaaaagatggagtacgggaagtgtttgagatggccactcgggctgccctgcag gccaagcgtggccgcaaaaagacctcgtgccagctgctgtaa

DBGET integrated database retrieval system