Varanus komodoensis (Komodo dragon): 123032138 Help Entry 123032138         CDS       T07701                                  Symbol NRAS Name (RefSeq) GTPase NRas isoform X1   KO K07828   GTPase NRas Organism vko  Varanus komodoensis (Komodo dragon) Pathway vko04010   MAPK signaling pathway vko04012   ErbB signaling pathway vko04068   FoxO signaling pathway vko04137   Mitophagy - animal vko04140   Autophagy - animal vko04150   mTOR signaling pathway vko04210   Apoptosis vko04218   Cellular senescence vko04370   VEGF signaling pathway vko04371   Apelin signaling pathway vko04540   Gap junction vko04625   C-type lectin receptor signaling pathway vko04810   Regulation of actin cytoskeleton vko04910   Insulin signaling pathway vko04912   GnRH signaling pathway vko04916   Melanogenesis Brite KEGG Orthology (KO) [BR:vko00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     123032138 (NRAS)    04012 ErbB signaling pathway     123032138 (NRAS)    04370 VEGF signaling pathway     123032138 (NRAS)    04371 Apelin signaling pathway     123032138 (NRAS)    04068 FoxO signaling pathway     123032138 (NRAS)    04150 mTOR signaling pathway     123032138 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     123032138 (NRAS)    04137 Mitophagy - animal     123032138 (NRAS)   09143 Cell growth and death    04210 Apoptosis     123032138 (NRAS)    04218 Cellular senescence     123032138 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     123032138 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     123032138 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     123032138 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     123032138 (NRAS)    04912 GnRH signaling pathway     123032138 (NRAS)    04916 Melanogenesis     123032138 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vko04131]     123032138 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vko04147]     123032138 (NRAS)    04031 GTP-binding proteins [BR:vko04031]     123032138 (NRAS) Membrane trafficking [BR:vko04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     123032138 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     123032138 (NRAS) Exosome [BR:vko04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123032138 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    123032138 (NRAS)   Exosomal proteins of breast cancer cells    123032138 (NRAS)   Exosomal proteins of colorectal cancer cells    123032138 (NRAS) GTP-binding proteins [BR:vko04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     123032138 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha FeoB_N Septin nSTAND3 Ldh_1_N Motif Other DBs NCBI-GeneID:  123032138 NCBI-ProteinID:  XP_044303754 Ensembl:  ENSVKKG00000013090 LinkDB All DBs Position Unknown AA seq 204 aa AA seqDB search MFCCITSMNRSLKSAMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVV IDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKD SEDVPMVLVGNKCDLPTRTVDTKQAHEVAKNYGIPFIETSAKTRQGVEDAFYTLVREIRQ YRMKRLNSSEDGNQGCMGLSCLVM NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atgttttgctgcatcacttctatgaacaggtctctgaagagtgcgatgaccgagtataag ctggtggtggtgggagctggtggtgttggaaaaagtgccctgactatacagctcatccag aaccactttgtggatgaatatgatcctactatagaggactcttaccgtaaacaggtagtt attgatggagagacttgtttgctagacatcctggacacagcagggcaagaggaatatagt gctatgagagaccagtacatgagaactggtgaaggttttctctgtgtgtttgccatcaac aacagcaaatcatttgcagatatcaatctttacagagagcagattaaaagagtgaaagat tcagaagatgtaccaatggtgttagtgggaaacaaatgtgacttgccaacacggacagta gacaccaaacaggctcatgaagtggccaagaactatgggattcccttcattgagacatct gctaaaacaagacagggtgttgaagatgccttttacacacttgtgagggagatccgccag tatcggatgaaaagactcaacagtagtgaagatgggaatcaaggctgcatggggctttca tgccttgtgatgtga

DBGET integrated database retrieval system