Varanus komodoensis (Komodo dragon): 123034341 Help Entry 123034341         CDS       T07701                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism vko  Varanus komodoensis (Komodo dragon) Pathway vko04137   Mitophagy - animal vko04140   Autophagy - animal vko04144   Endocytosis vko04145   Phagosome vko04148   Efferocytosis vko05132   Salmonella infection Brite KEGG Orthology (KO) [BR:vko00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     123034341 (RAB7A)    04145 Phagosome     123034341 (RAB7A)    04140 Autophagy - animal     123034341 (RAB7A)    04137 Mitophagy - animal     123034341 (RAB7A)    04148 Efferocytosis     123034341 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     123034341 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vko04131]     123034341 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vko04147]     123034341 (RAB7A)    04031 GTP-binding proteins [BR:vko04031]     123034341 (RAB7A) Membrane trafficking [BR:vko04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     123034341 (RAB7A) Exosome [BR:vko04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123034341 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    123034341 (RAB7A)   Exosomal proteins of colorectal cancer cells    123034341 (RAB7A)   Exosomal proteins of bladder cancer cells    123034341 (RAB7A) GTP-binding proteins [BR:vko04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     123034341 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  123034341 NCBI-ProteinID:  XP_044307598 Ensembl:  ENSVKKG00000001030 UniProt:  A0A8D2IJC9 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttctagaaagaaagtattgctcaaagtcatcatccttggagactcaggggtggga aagacatctcttatgaatcagtatgtgaacaagaaattcagtaaccagtacaaagctaca ataggagcagactttctgacgaaggaggtgatggtggatgataggctagtcacaatgcag atatgggatacagcagggcaggaacggtttcagtcgctgggagtagccttctacagagga gcggactgctgtgtgctggtgtttgatgtaacagctcccaacacatttaaaactctggac agctggcgagatgagttcctcattcaagccagtccacgggatcctgaaaactttcctttt gttgtgctgggaaacaagattgacctagaaaacagacaagttactacaaaacgagcacag gcctggtgctacagcaaaaacaatatcccttactttgaaaccagtgccaaggaggccatt aatgtggaacaagctttccagacaattgcacgaaatgcacttaaacaggaaactgaagtg gagctttacaatgaattccctgaacctatcaaactagacaagaatgatcgagcaaaggct tctgcggagagctgcagctgctga

DBGET integrated database retrieval system