Vulpes lagopus (Arctic fox): 121471422 Help Entry 121471422         CDS       T07435                                  Symbol POLD4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg03030   DNA replication vlg03410   Base excision repair vlg03420   Nucleotide excision repair vlg03430   Mismatch repair vlg03440   Homologous recombination Brite KEGG Orthology (KO) [BR:vlg00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     121471422 (POLD4)    03410 Base excision repair     121471422 (POLD4)    03420 Nucleotide excision repair     121471422 (POLD4)    03430 Mismatch repair     121471422 (POLD4)    03440 Homologous recombination     121471422 (POLD4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:vlg03032]     121471422 (POLD4)    03400 DNA repair and recombination proteins [BR:vlg03400]     121471422 (POLD4) DNA replication proteins [BR:vlg03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     121471422 (POLD4) DNA repair and recombination proteins [BR:vlg03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       121471422 (POLD4)    MMR (mismatch excision repair)     DNA polymerase delta complex      121471422 (POLD4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 DUF3303 Motif Other DBs NCBI-GeneID:  121471422 NCBI-ProteinID:  XP_041578114 LinkDB All DBs Position 11:73734314..73737515 Genome browser AA seq 107 aa AA seqDB search MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPLSVDEAELELLRQFDLAWQYGP CTGITRLQRWHRAEQMGLEPPPEVRQVLQTHPGDPRFQCSLWHLYPL NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgggccggaagcggctcatcactgactcctaccccgtagtgaagaggagggagggcccc gctgggcacagcaagggggagctggcaccagagctaggggaagagccccagcccctgagc gtggatgaagcagagctggagctgctgaggcagtttgatctcgcctggcagtatgggccc tgcacagggatcacacggttgcagcgctggcatcgggcggagcagatgggcttggagcct cccccagaagtgcgtcaggtgctacagacccaccctggagatccccgcttccagtgcagc ctctggcatctctatcccctgtga

DBGET integrated database retrieval system