KEGG   Vulpes lagopus (Arctic fox): 121475510
Entry
121475510         CDS       T07435                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
vlg  Vulpes lagopus (Arctic fox)
Pathway
vlg01521  EGFR tyrosine kinase inhibitor resistance
vlg01522  Endocrine resistance
vlg01524  Platinum drug resistance
vlg04010  MAPK signaling pathway
vlg04012  ErbB signaling pathway
vlg04014  Ras signaling pathway
vlg04015  Rap1 signaling pathway
vlg04022  cGMP-PKG signaling pathway
vlg04024  cAMP signaling pathway
vlg04062  Chemokine signaling pathway
vlg04066  HIF-1 signaling pathway
vlg04068  FoxO signaling pathway
vlg04071  Sphingolipid signaling pathway
vlg04072  Phospholipase D signaling pathway
vlg04114  Oocyte meiosis
vlg04140  Autophagy - animal
vlg04148  Efferocytosis
vlg04150  mTOR signaling pathway
vlg04151  PI3K-Akt signaling pathway
vlg04210  Apoptosis
vlg04218  Cellular senescence
vlg04261  Adrenergic signaling in cardiomyocytes
vlg04270  Vascular smooth muscle contraction
vlg04350  TGF-beta signaling pathway
vlg04360  Axon guidance
vlg04370  VEGF signaling pathway
vlg04371  Apelin signaling pathway
vlg04380  Osteoclast differentiation
vlg04510  Focal adhesion
vlg04520  Adherens junction
vlg04540  Gap junction
vlg04550  Signaling pathways regulating pluripotency of stem cells
vlg04611  Platelet activation
vlg04613  Neutrophil extracellular trap formation
vlg04620  Toll-like receptor signaling pathway
vlg04621  NOD-like receptor signaling pathway
vlg04625  C-type lectin receptor signaling pathway
vlg04650  Natural killer cell mediated cytotoxicity
vlg04657  IL-17 signaling pathway
vlg04658  Th1 and Th2 cell differentiation
vlg04659  Th17 cell differentiation
vlg04660  T cell receptor signaling pathway
vlg04662  B cell receptor signaling pathway
vlg04664  Fc epsilon RI signaling pathway
vlg04666  Fc gamma R-mediated phagocytosis
vlg04668  TNF signaling pathway
vlg04713  Circadian entrainment
vlg04720  Long-term potentiation
vlg04722  Neurotrophin signaling pathway
vlg04723  Retrograde endocannabinoid signaling
vlg04724  Glutamatergic synapse
vlg04725  Cholinergic synapse
vlg04726  Serotonergic synapse
vlg04730  Long-term depression
vlg04810  Regulation of actin cytoskeleton
vlg04910  Insulin signaling pathway
vlg04912  GnRH signaling pathway
vlg04914  Progesterone-mediated oocyte maturation
vlg04915  Estrogen signaling pathway
vlg04916  Melanogenesis
vlg04917  Prolactin signaling pathway
vlg04919  Thyroid hormone signaling pathway
vlg04921  Oxytocin signaling pathway
vlg04926  Relaxin signaling pathway
vlg04928  Parathyroid hormone synthesis, secretion and action
vlg04929  GnRH secretion
vlg04930  Type II diabetes mellitus
vlg04933  AGE-RAGE signaling pathway in diabetic complications
vlg04934  Cushing syndrome
vlg04935  Growth hormone synthesis, secretion and action
vlg04960  Aldosterone-regulated sodium reabsorption
vlg05010  Alzheimer disease
vlg05020  Prion disease
vlg05022  Pathways of neurodegeneration - multiple diseases
vlg05034  Alcoholism
vlg05132  Salmonella infection
vlg05133  Pertussis
vlg05135  Yersinia infection
vlg05140  Leishmaniasis
vlg05142  Chagas disease
vlg05145  Toxoplasmosis
vlg05152  Tuberculosis
vlg05160  Hepatitis C
vlg05161  Hepatitis B
vlg05163  Human cytomegalovirus infection
vlg05164  Influenza A
vlg05165  Human papillomavirus infection
vlg05166  Human T-cell leukemia virus 1 infection
vlg05167  Kaposi sarcoma-associated herpesvirus infection
vlg05170  Human immunodeficiency virus 1 infection
vlg05171  Coronavirus disease - COVID-19
vlg05200  Pathways in cancer
vlg05203  Viral carcinogenesis
vlg05205  Proteoglycans in cancer
vlg05206  MicroRNAs in cancer
vlg05207  Chemical carcinogenesis - receptor activation
vlg05208  Chemical carcinogenesis - reactive oxygen species
vlg05210  Colorectal cancer
vlg05211  Renal cell carcinoma
vlg05212  Pancreatic cancer
vlg05213  Endometrial cancer
vlg05214  Glioma
vlg05215  Prostate cancer
vlg05216  Thyroid cancer
vlg05218  Melanoma
vlg05219  Bladder cancer
vlg05220  Chronic myeloid leukemia
vlg05221  Acute myeloid leukemia
vlg05223  Non-small cell lung cancer
vlg05224  Breast cancer
vlg05225  Hepatocellular carcinoma
vlg05226  Gastric cancer
vlg05230  Central carbon metabolism in cancer
vlg05231  Choline metabolism in cancer
vlg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
vlg05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vlg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    121475510 (MAPK1)
   04012 ErbB signaling pathway
    121475510 (MAPK1)
   04014 Ras signaling pathway
    121475510 (MAPK1)
   04015 Rap1 signaling pathway
    121475510 (MAPK1)
   04350 TGF-beta signaling pathway
    121475510 (MAPK1)
   04370 VEGF signaling pathway
    121475510 (MAPK1)
   04371 Apelin signaling pathway
    121475510 (MAPK1)
   04668 TNF signaling pathway
    121475510 (MAPK1)
   04066 HIF-1 signaling pathway
    121475510 (MAPK1)
   04068 FoxO signaling pathway
    121475510 (MAPK1)
   04072 Phospholipase D signaling pathway
    121475510 (MAPK1)
   04071 Sphingolipid signaling pathway
    121475510 (MAPK1)
   04024 cAMP signaling pathway
    121475510 (MAPK1)
   04022 cGMP-PKG signaling pathway
    121475510 (MAPK1)
   04151 PI3K-Akt signaling pathway
    121475510 (MAPK1)
   04150 mTOR signaling pathway
    121475510 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    121475510 (MAPK1)
   04148 Efferocytosis
    121475510 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    121475510 (MAPK1)
   04210 Apoptosis
    121475510 (MAPK1)
   04218 Cellular senescence
    121475510 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    121475510 (MAPK1)
   04520 Adherens junction
    121475510 (MAPK1)
   04540 Gap junction
    121475510 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    121475510 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    121475510 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    121475510 (MAPK1)
   04613 Neutrophil extracellular trap formation
    121475510 (MAPK1)
   04620 Toll-like receptor signaling pathway
    121475510 (MAPK1)
   04621 NOD-like receptor signaling pathway
    121475510 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    121475510 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    121475510 (MAPK1)
   04660 T cell receptor signaling pathway
    121475510 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    121475510 (MAPK1)
   04659 Th17 cell differentiation
    121475510 (MAPK1)
   04657 IL-17 signaling pathway
    121475510 (MAPK1)
   04662 B cell receptor signaling pathway
    121475510 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    121475510 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    121475510 (MAPK1)
   04062 Chemokine signaling pathway
    121475510 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    121475510 (MAPK1)
   04929 GnRH secretion
    121475510 (MAPK1)
   04912 GnRH signaling pathway
    121475510 (MAPK1)
   04915 Estrogen signaling pathway
    121475510 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    121475510 (MAPK1)
   04917 Prolactin signaling pathway
    121475510 (MAPK1)
   04921 Oxytocin signaling pathway
    121475510 (MAPK1)
   04926 Relaxin signaling pathway
    121475510 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    121475510 (MAPK1)
   04919 Thyroid hormone signaling pathway
    121475510 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    121475510 (MAPK1)
   04916 Melanogenesis
    121475510 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    121475510 (MAPK1)
   04270 Vascular smooth muscle contraction
    121475510 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    121475510 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    121475510 (MAPK1)
   04725 Cholinergic synapse
    121475510 (MAPK1)
   04726 Serotonergic synapse
    121475510 (MAPK1)
   04720 Long-term potentiation
    121475510 (MAPK1)
   04730 Long-term depression
    121475510 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    121475510 (MAPK1)
   04722 Neurotrophin signaling pathway
    121475510 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    121475510 (MAPK1)
   04380 Osteoclast differentiation
    121475510 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    121475510 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    121475510 (MAPK1)
   05206 MicroRNAs in cancer
    121475510 (MAPK1)
   05205 Proteoglycans in cancer
    121475510 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    121475510 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    121475510 (MAPK1)
   05203 Viral carcinogenesis
    121475510 (MAPK1)
   05230 Central carbon metabolism in cancer
    121475510 (MAPK1)
   05231 Choline metabolism in cancer
    121475510 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    121475510 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    121475510 (MAPK1)
   05212 Pancreatic cancer
    121475510 (MAPK1)
   05225 Hepatocellular carcinoma
    121475510 (MAPK1)
   05226 Gastric cancer
    121475510 (MAPK1)
   05214 Glioma
    121475510 (MAPK1)
   05216 Thyroid cancer
    121475510 (MAPK1)
   05221 Acute myeloid leukemia
    121475510 (MAPK1)
   05220 Chronic myeloid leukemia
    121475510 (MAPK1)
   05218 Melanoma
    121475510 (MAPK1)
   05211 Renal cell carcinoma
    121475510 (MAPK1)
   05219 Bladder cancer
    121475510 (MAPK1)
   05215 Prostate cancer
    121475510 (MAPK1)
   05213 Endometrial cancer
    121475510 (MAPK1)
   05224 Breast cancer
    121475510 (MAPK1)
   05223 Non-small cell lung cancer
    121475510 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    121475510 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    121475510 (MAPK1)
   05161 Hepatitis B
    121475510 (MAPK1)
   05160 Hepatitis C
    121475510 (MAPK1)
   05171 Coronavirus disease - COVID-19
    121475510 (MAPK1)
   05164 Influenza A
    121475510 (MAPK1)
   05163 Human cytomegalovirus infection
    121475510 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    121475510 (MAPK1)
   05165 Human papillomavirus infection
    121475510 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    121475510 (MAPK1)
   05135 Yersinia infection
    121475510 (MAPK1)
   05133 Pertussis
    121475510 (MAPK1)
   05152 Tuberculosis
    121475510 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    121475510 (MAPK1)
   05140 Leishmaniasis
    121475510 (MAPK1)
   05142 Chagas disease
    121475510 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    121475510 (MAPK1)
   05020 Prion disease
    121475510 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    121475510 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    121475510 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    121475510 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    121475510 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    121475510 (MAPK1)
   04934 Cushing syndrome
    121475510 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    121475510 (MAPK1)
   01524 Platinum drug resistance
    121475510 (MAPK1)
   01522 Endocrine resistance
    121475510 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vlg01001]
    121475510 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:vlg03036]
    121475510 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vlg04147]
    121475510 (MAPK1)
Enzymes [BR:vlg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     121475510 (MAPK1)
Protein kinases [BR:vlg01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   121475510 (MAPK1)
Chromosome and associated proteins [BR:vlg03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     121475510 (MAPK1)
Exosome [BR:vlg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   121475510 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 121475510
NCBI-ProteinID: XP_041584761
LinkDB
Position
14:complement(9814831..9936575)
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaacctctcctacatcggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagtccttttgag
caccagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacat
gagaacatcattggaatcaatgatattattcgagcaccaaccatcgagcaaatgaaagat
gtatatatagtacaagacctcatggaaacagatctctacaagctcttgaagacacaacac
ctcagcaacgaccatatctgctattttctttaccagatcctcagagggttaaaatatatc
cattcagctaatgtactgcaccgtgacctcaaaccttccaacctgctgctcaataccacc
tgcgatctcaagatctgtgactttggcttggcccgtgttgcagatccggatcatgatcac
acagggttcctgacggagtatgtagccacacgttggtacagggctccagaaattatgttg
aattccaagggctataccaagtccattgatatttggtctgtaggctgcattctggcagag
atgctgtccaacaggcccatcttcccggggaagcattatctcgaccagctgaaccacatt
ttgggtattcttggatccccatcacaggaagacctgaactgtataataaatttaaaagct
agaaactacttgctttctcttccacacaaaaataaggtgccatggaacaggctgttccca
aatgctgactccaaagctctggatttactggacaaaatgttgacattcaaccctcacaag
aggattgaagtagaacaggctctggcccatccgtatctggaacagtattatgacccaagt
gatgagcccatcgctgaggcgccattcaagtttgacatggagctggatgacctgcccaag
gaaaagctcaaggagctcatcttcgaagagacagctagattccagccgggatacagatct
taa

DBGET integrated database retrieval system