Vulpes lagopus (Arctic fox): 121477529 Help Entry 121477529         CDS       T07435                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04060   Cytokine-cytokine receptor interaction vlg04620   Toll-like receptor signaling pathway vlg04622   RIG-I-like receptor signaling pathway vlg04625   C-type lectin receptor signaling pathway vlg04630   JAK-STAT signaling pathway vlg04658   Th1 and Th2 cell differentiation vlg04936   Alcoholic liver disease vlg04940   Type I diabetes mellitus vlg05133   Pertussis vlg05134   Legionellosis vlg05140   Leishmaniasis vlg05142   Chagas disease vlg05143   African trypanosomiasis vlg05144   Malaria vlg05145   Toxoplasmosis vlg05146   Amoebiasis vlg05152   Tuberculosis vlg05162   Measles vlg05164   Influenza A vlg05168   Herpes simplex virus 1 infection vlg05171   Coronavirus disease - COVID-19 vlg05200   Pathways in cancer vlg05321   Inflammatory bowel disease vlg05330   Allograft rejection vlg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:vlg00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     121477529 (IL12A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121477529 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121477529 (IL12A)    04622 RIG-I-like receptor signaling pathway     121477529 (IL12A)    04625 C-type lectin receptor signaling pathway     121477529 (IL12A)    04658 Th1 and Th2 cell differentiation     121477529 (IL12A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121477529 (IL12A)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     121477529 (IL12A)    05164 Influenza A     121477529 (IL12A)    05162 Measles     121477529 (IL12A)    05168 Herpes simplex virus 1 infection     121477529 (IL12A)   09171 Infectious disease: bacterial    05133 Pertussis     121477529 (IL12A)    05134 Legionellosis     121477529 (IL12A)    05152 Tuberculosis     121477529 (IL12A)   09174 Infectious disease: parasitic    05146 Amoebiasis     121477529 (IL12A)    05144 Malaria     121477529 (IL12A)    05145 Toxoplasmosis     121477529 (IL12A)    05140 Leishmaniasis     121477529 (IL12A)    05142 Chagas disease     121477529 (IL12A)    05143 African trypanosomiasis     121477529 (IL12A)   09163 Immune disease    05321 Inflammatory bowel disease     121477529 (IL12A)    05330 Allograft rejection     121477529 (IL12A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121477529 (IL12A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     121477529 (IL12A)    04936 Alcoholic liver disease     121477529 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vlg04052]     121477529 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:vlg00536]     121477529 (IL12A) Cytokines and neuropeptides [BR:vlg04052]  Cytokines   Interleukins    121477529 (IL12A) Glycosaminoglycan binding proteins [BR:vlg00536]  Heparan sulfate / Heparin   Cytokines    121477529 (IL12A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL12 Motif Other DBs NCBI-GeneID:  121477529 NCBI-ProteinID:  XP_041587859 LinkDB All DBs Position 17:complement(15961477..15969397) Genome browser AA seq 222 aa AA seqDB search MCPPRGLLLVTILVLLSHLHLLTWARSLPTASPSPGIFQCLNHSQNLLRAVSDALQKARQ TLELYSCTSEEIDHEDITKDKTSTVEACLPLELTMNESCLASREVSLITNGSCLASGKAS FMTVLCLSSIYEDLKMYQMEFKAMNAKLLMDPKRQIFLDQNMLTAIDELLQALNFNSVTV PQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRMMSYLNSS NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atgtgcccgccgcgcggcctcctccttgtgaccatcctggtcctcctaagccacctgcac ctccttacttgggccaggagcctccccacagcctcaccaagcccaggaatattccagtgc ctcaaccactcccaaaacctgctgagagccgtcagcgacgcgcttcagaaggccagacaa actctagaattatattcctgcacttccgaagagattgatcatgaagatatcacaaaggat aaaaccagcacagtggaggcctgcttaccactggaattaaccatgaatgagagttgcctg gcttccagagaggtctctttgataactaacgggagttgcctggcctctggaaaggcctct tttatgacggtcctgtgccttagcagcatctatgaggacttgaagatgtaccagatggaa ttcaaggccatgaacgcaaagcttttaatggatcccaagaggcagatctttctggatcaa aacatgctgacagctatcgatgagctgttacaggccctgaatttcaacagtgtgactgtg ccacagaaatcctcccttgaagagccggatttttataaaactaaaatcaagctctgcata cttcttcatgctttcagaattcgtgcggtgaccatcgatagaatgatgagctatctgaat tcttcctaa

DBGET integrated database retrieval system