Vulpes lagopus (Arctic fox): 121478042 Help Entry 121478042         CDS       T07435                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg01521   EGFR tyrosine kinase inhibitor resistance vlg01524   Platinum drug resistance vlg04014   Ras signaling pathway vlg04064   NF-kappa B signaling pathway vlg04115   p53 signaling pathway vlg04137   Mitophagy - animal vlg04140   Autophagy - animal vlg04151   PI3K-Akt signaling pathway vlg04210   Apoptosis vlg04215   Apoptosis - multiple species vlg04621   NOD-like receptor signaling pathway vlg04630   JAK-STAT signaling pathway vlg05012   Parkinson disease vlg05014   Amyotrophic lateral sclerosis vlg05022   Pathways of neurodegeneration - multiple diseases vlg05145   Toxoplasmosis vlg05162   Measles vlg05166   Human T-cell leukemia virus 1 infection vlg05168   Herpes simplex virus 1 infection vlg05170   Human immunodeficiency virus 1 infection vlg05200   Pathways in cancer vlg05202   Transcriptional misregulation in cancer vlg05212   Pancreatic cancer vlg05220   Chronic myeloid leukemia vlg05222   Small cell lung cancer vlg05225   Hepatocellular carcinoma vlg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:vlg00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     121478042 (BCL2L1)    04630 JAK-STAT signaling pathway     121478042 (BCL2L1)    04064 NF-kappa B signaling pathway     121478042 (BCL2L1)    04151 PI3K-Akt signaling pathway     121478042 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121478042 (BCL2L1)    04137 Mitophagy - animal     121478042 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     121478042 (BCL2L1)    04215 Apoptosis - multiple species     121478042 (BCL2L1)    04115 p53 signaling pathway     121478042 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     121478042 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121478042 (BCL2L1)    05202 Transcriptional misregulation in cancer     121478042 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     121478042 (BCL2L1)    05225 Hepatocellular carcinoma     121478042 (BCL2L1)    05220 Chronic myeloid leukemia     121478042 (BCL2L1)    05222 Small cell lung cancer     121478042 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     121478042 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     121478042 (BCL2L1)    05162 Measles     121478042 (BCL2L1)    05168 Herpes simplex virus 1 infection     121478042 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     121478042 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     121478042 (BCL2L1)    05014 Amyotrophic lateral sclerosis     121478042 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     121478042 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121478042 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     121478042 (BCL2L1)    01524 Platinum drug resistance     121478042 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:vlg01009]     121478042 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vlg03036]     121478042 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:vlg02000]     121478042 (BCL2L1) Protein phosphatases and associated proteins [BR:vlg01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      121478042 (BCL2L1) Chromosome and associated proteins [BR:vlg03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     121478042 (BCL2L1) Transporters [BR:vlg02000]  Other transporters   Pores ion channels [TC:1]    121478042 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  121478042 NCBI-ProteinID:  XP_041588726 LinkDB All DBs Position 18:26671098..26721233 Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggca gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcggtgaaacaagcgctgagggaggctggggatgagtttgaactgagg taccggcgggcattcagtgacctgacatcccagcttcacatcaccccagggacagcatat cagagctttgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggagagcgtagacaaggagatgcag gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggatacttttgtggaactctacgggaacaatgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg gctggcgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system