Vulpes lagopus (Arctic fox): 121478865 Help Entry 121478865         CDS       T07435                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04014   Ras signaling pathway vlg04137   Mitophagy - animal vlg04144   Endocytosis vlg04145   Phagosome vlg04148   Efferocytosis vlg04962   Vasopressin-regulated water reabsorption vlg05014   Amyotrophic lateral sclerosis vlg05022   Pathways of neurodegeneration - multiple diseases vlg05132   Salmonella infection vlg05146   Amoebiasis vlg05152   Tuberculosis Brite KEGG Orthology (KO) [BR:vlg00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     121478865 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     121478865 (RAB5A)    04145 Phagosome     121478865 (RAB5A)    04137 Mitophagy - animal     121478865 (RAB5A)    04148 Efferocytosis     121478865 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     121478865 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121478865 (RAB5A)    05152 Tuberculosis     121478865 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     121478865 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     121478865 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     121478865 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vlg04131]     121478865 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vlg04147]     121478865 (RAB5A)    04031 GTP-binding proteins [BR:vlg04031]     121478865 (RAB5A) Membrane trafficking [BR:vlg04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     121478865 (RAB5A)  Endosome - Lysosome transport     121478865 (RAB5A) Exosome [BR:vlg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121478865 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    121478865 (RAB5A)   Exosomal proteins of colorectal cancer cells    121478865 (RAB5A)   Exosomal proteins of bladder cancer cells    121478865 (RAB5A) GTP-binding proteins [BR:vlg04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     121478865 (RAB5A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  121478865 NCBI-ProteinID:  XP_041590197 LinkDB All DBs Position 19:complement(23951432..23980599) Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagcctagtgcttcgtttt gtgaagggccaatttcatgaatttcaagagagtaccataggggctgcttttctaacccaa actgtgtgtcttgatgatacaacagtaaagtttgaaatatgggatacagctggtcaagaa cgataccatagcttagcaccaatgtactacagaggagcacaagcagccatagttgtatat gatatcacaaatgaggagtcctttgccagagccaaaaactgggttaaagaacttcagagg caagccagtcctaacattgtaatagctttatcaggaaacaaggctgatcttgcaaataaa agagctgtcgatttccaggaagcacagtcctatgcagatgacaacagtttattattcatg gagacatcagctaaaacatcgatgaatgtaaatgaaatattcatggcaatagctaaaaag ttgccaaagaacgaaccacagaatccaggagcaaattctgccagaggaagaggagtagac cttactgaacccacgcagccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system