Vulpes lagopus (Arctic fox): 121478980 Help Entry 121478980         CDS       T07435                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04015   Rap1 signaling pathway vlg04810   Regulation of actin cytoskeleton vlg05014   Amyotrophic lateral sclerosis vlg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:vlg00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     121478980 (PFN2)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     121478980 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vlg04131]     121478980 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:vlg04812]     121478980 (PFN2)    04147 Exosome [BR:vlg04147]     121478980 (PFN2) Membrane trafficking [BR:vlg04131]  Others   Actin-binding proteins    Others     121478980 (PFN2) Cytoskeleton proteins [BR:vlg04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      121478980 (PFN2) Exosome [BR:vlg04147]  Exosomal proteins   Proteins found in most exosomes    121478980 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  121478980 NCBI-ProteinID:  XP_041590423 LinkDB All DBs Position 19:complement(45406545..45412497) Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggacaacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcatcacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcaaagaagtgctcggtgatcagagatagcctatacgtc gacggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac gttgctgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system